BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30276X (353 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 0.48 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 25 0.83 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 2.5 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 4.4 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 23 4.4 Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. 22 5.9 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 22 5.9 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 22 7.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 22 7.8 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.8 bits (54), Expect = 0.48 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 224 MRSNLWSRRAQAPAMAVVLDNM 159 MR+N WS +AP A+ L M Sbjct: 55 MRTNRWSSHPEAPGKAIYLTRM 76 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 25.0 bits (52), Expect = 0.83 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +1 Query: 112 TVVPGGDLAKVQRAVIMLSNTTAIAGAWARLDHKFDLMYAKRAFV 246 T + D+AKV+ AV++ + ++ A +++ +DL A A + Sbjct: 991 TALLENDIAKVKHAVVIQNGMNYLSNQLAFINNPYDLSIATYAMM 1035 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 23.4 bits (48), Expect = 2.5 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = -3 Query: 303 VPHGLRRTLP-PPYPH--RLPVHESTLGVHEVELVVKASPS 190 +P LR + P PYPH R V E + EVE+ ++S S Sbjct: 323 LPFILRMSRPGEPYPHPCRPTVDEKNKQLQEVEMRERSSKS 363 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 22.6 bits (46), Expect = 4.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 102 VVDSDLETGWTPVDELDSTLGFDGSDGRV 16 +VD + + W P ELD GF G + V Sbjct: 350 IVDFCVGSLWGPKSELDVARGFVGYNATV 378 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 303 VPHGLRRTLPPPYPHRLPVHE 241 VPH ++ +P PYP ++ V + Sbjct: 186 VPHYVKVYIPQPYPLQVNVEQ 206 >Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 22.2 bits (45), Expect = 5.9 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +3 Query: 12 CERGHRYHQNQAYYPIRRLV 71 C + H HQ + YP+ R + Sbjct: 18 CAQAHASHQRRVPYPLPRFL 37 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 22.2 bits (45), Expect = 5.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 315 RGQPVPHGLRRTLPPPYPHRLPVHESTLGVHEVE 214 RG+P P G L PP P P ++ + + +++ Sbjct: 627 RGEPGPKGEPGLLGPPGPSGEPGRDAEIPMDQLK 660 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 4 PKDVNAAIATIKTKRTIQFVDWCPTGFKVGIN 99 PKD N +A I F ++ P G++ ++ Sbjct: 79 PKDHNYVVAYIDRPTYAAFNEYLPRGYRTELS 110 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 4 PKDVNAAIATIKTKRTIQFVDWCPTGFKVGIN 99 PKD N +A I F ++ P G++ ++ Sbjct: 79 PKDHNYVVAYIDRPTYAAFNEYLPRGYRTELS 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 372,237 Number of Sequences: 2352 Number of extensions: 7729 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 25794900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -