BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30276X (353 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 24 0.46 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 1.4 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 2.5 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 3.3 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 4.3 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 5.7 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 5.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 5.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 5.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 5.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 5.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 20 9.9 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 24.2 bits (50), Expect = 0.46 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVHESTLGVHEV 217 P QP H RR PP P R + T+G EV Sbjct: 238 PLYQQPERHYERRATPP-QPDRTSKDQGTIGESEV 271 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.6 bits (46), Expect = 1.4 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +1 Query: 163 LSNTTAIAGAWARLDHKFDLMYAKRAFVHW*SVRVWRRESSPKPVRNW 306 L+NT + W LD+ FD ++A + S R ++ P V W Sbjct: 32 LTNTLNVIHKWKYLDYDFDNDERRQAAIQ--SGEYDRTKNYPLDVDQW 77 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.8 bits (44), Expect = 2.5 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = -3 Query: 315 RGQPVPHGLRRTLPPPYPHRLPVHESTLGVHEVELVVKASP 193 R P H + + PP + LP+++S +H +++ + SP Sbjct: 48 RFSPSTHLMDLSSPPEH-RDLPIYQSHHHLHHHQVLYQQSP 87 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 3.3 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 345 SQCRLLRNPYRGQPVPHGLRRTLPPPYPHRLPVH 244 ++CR +R + P + T PP P L V+ Sbjct: 294 TECRCDPGYFRAEKDPKKMPCTQPPSAPQNLTVN 327 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.0 bits (42), Expect = 4.3 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -1 Query: 326 VILIEGSQFLTGFGELSLLHTLTDYQCTKARLAYMRS 216 V L F+T F S LH + + TK R R+ Sbjct: 261 VRLSSARAFITPFENRSNLHVIVNATVTKVRTLNKRA 297 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 127 PFPPRFIPPDMYRLRPPPNPRFGPMY 152 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 127 PFPPRFIPPDMYRLRPPPNPRFGPMY 152 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 127 PFPPRFIPPDMYRLRPPPNPRFGPMY 152 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 127 PFPPRFIPPDMYRLRPPPNPRFGPMY 152 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 127 PFPPRFIPPDMYRLRPPPNPRFGPMY 152 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 127 PFPPRFIPPDMYRLRPPPNPRFGPMY 152 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 127 PFPPRFIPPDMYRLRPPPNPRFGPMY 152 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 376 PFPPRFIPPDMYRLRPPPNPRFGPMY 401 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 376 PFPPRFIPPDMYRLRPPPNPRFGPMY 401 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 376 PFPPRFIPPDMYRLRPPPNPRFGPMY 401 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 376 PFPPRFIPPDMYRLRPPPNPRFGPMY 401 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 376 PFPPRFIPPDMYRLRPPPNPRFGPMY 401 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 376 PFPPRFIPPDMYRLRPPPNPRFGPMY 401 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 375 PFPPRFIPPDMYRLRPPPNPRFGPMY 400 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 360 PFPPRFIPPDMYRLRPPPNPRFGPMY 385 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 5.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 321 PYRGQPVPHGLRRTLPPPYPHRLPVH 244 P+ + +P + R PPP P P++ Sbjct: 376 PFPPRFIPPDMYRLRPPPNPRFGPMY 401 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 19.8 bits (39), Expect = 9.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 311 GSQFLTGFGELSLLHTLTDY 252 GS+ TG +L + L DY Sbjct: 109 GSENYTGISDLFVFDDLNDY 128 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,027 Number of Sequences: 438 Number of extensions: 2073 Number of successful extensions: 22 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8184330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -