BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30275 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 28 0.074 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 3.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 3.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 3.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 3.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 3.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 6.4 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 8.5 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.5 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 8.5 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 28.3 bits (60), Expect = 0.074 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 447 GICNPIITKMYQGAGGVPGGIRASRAEHP-EPEVPPPGL 560 G+ P + QG+ G+P I A R HP + PPG+ Sbjct: 332 GLQPPDLAGTSQGSAGLPSAILAMRLSHPLHGNLLPPGV 370 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.7 Identities = 23/93 (24%), Positives = 43/93 (46%) Frame = +3 Query: 153 HYQRQRSSLQGRDRAYG**GREVQKRG*QEKGDHQAKNALESYCFSMKSTMEDEKLKEKI 332 HY R+RS + R+R Y R+ +R EK ++ + LE S K + ++K+ Sbjct: 230 HYSRERSCSRDRNREY----RKKDRR--YEKLHNEKEKLLEERT-SCKRYSRSREREQKL 282 Query: 333 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHK 431 ++++ K +T K N+ ++ E K Sbjct: 283 YKNERE--YRKYGETSKERSRNRTEREKSKEPK 313 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.7 Identities = 23/93 (24%), Positives = 43/93 (46%) Frame = +3 Query: 153 HYQRQRSSLQGRDRAYG**GREVQKRG*QEKGDHQAKNALESYCFSMKSTMEDEKLKEKI 332 HY R+RS + R+R Y R+ +R EK ++ + LE S K + ++K+ Sbjct: 230 HYSRERSCSRDRNREY----RKKDRR--YEKLHNEKEKLLEERT-SCKRYSRSREREQKL 282 Query: 333 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHK 431 ++++ K +T K N+ ++ E K Sbjct: 283 YKNERE--YRKYGETSKERSRNRTEREKSKEPK 313 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.7 Identities = 23/93 (24%), Positives = 43/93 (46%) Frame = +3 Query: 153 HYQRQRSSLQGRDRAYG**GREVQKRG*QEKGDHQAKNALESYCFSMKSTMEDEKLKEKI 332 HY R+RS + R+R Y R+ +R EK ++ + LE S K + ++K+ Sbjct: 230 HYSRERSCSRDRNREY----RKKDRR--YEKLHNEKEKLLEERT-SCKRYSRSREREQKL 282 Query: 333 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHK 431 ++++ K +T K N+ ++ E K Sbjct: 283 YKNERE--YRKYGETSKERSRNRTEREKSKEPK 313 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.7 Identities = 23/93 (24%), Positives = 43/93 (46%) Frame = +3 Query: 153 HYQRQRSSLQGRDRAYG**GREVQKRG*QEKGDHQAKNALESYCFSMKSTMEDEKLKEKI 332 HY R+RS + R+R Y R+ +R EK ++ + LE S K + ++K+ Sbjct: 230 HYSRERSCSRDRNREY----RKKDRR--YEKLHNEKEKLLEERT-SCKRYSRSREREQKL 282 Query: 333 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHK 431 ++++ K +T K N+ ++ E K Sbjct: 283 YKNERE--YRKYGETSKERSRNRTEREKSKEPK 313 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 3.7 Identities = 23/93 (24%), Positives = 43/93 (46%) Frame = +3 Query: 153 HYQRQRSSLQGRDRAYG**GREVQKRG*QEKGDHQAKNALESYCFSMKSTMEDEKLKEKI 332 HY R+RS + R+R Y R+ +R EK ++ + LE S K + ++K+ Sbjct: 219 HYSRERSCSRDRNREY----RKKDRR--YEKLHNEKEKLLEERT-SCKRYSRSREREQKL 271 Query: 333 SDSDKQTILDKCNDTIKWLDSNQLADKEEYEHK 431 ++++ K +T K N+ ++ E K Sbjct: 272 YKNERE--YRKYGETSKERSRNRTEREKSKEPK 302 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 153 HYQRQRSSLQGRDRAY 200 HY R+RS + R+R Y Sbjct: 230 HYSRERSCSRDRNREY 245 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 6.4 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 93 QRYPKRFRYREVHQ-QGEQDHHYQRQRSSLQGRDR 194 +RY R R RE + + E+++ R+RS + RDR Sbjct: 270 KRY-SRSREREQNSYKNEREYRKYRERSKERSRDR 303 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.4 bits (43), Expect = 8.5 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +3 Query: 459 PIITKMYQGAGGVPGGIRASRAEHPEPEVPPPGLE 563 P T+ GA G A E P P +P PG + Sbjct: 450 PSATRYDLGAVATVGTTVAPCFEEPLPSLPLPGAD 484 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +3 Query: 294 KSTMEDEKLKEKISDSDKQTILDKCN 371 + +++ EK+K +S +T+ KCN Sbjct: 331 RCSVKREKIKISVSYPSTETLNTKCN 356 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 56 PRGAGGIPVS 27 PRG GG+P S Sbjct: 399 PRGPGGVPTS 408 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,500 Number of Sequences: 438 Number of extensions: 3926 Number of successful extensions: 32 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -