BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30271 (705 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 29 0.65 SPBC1198.01 |||glutathione-dependent formaldehyde dehydrogenase ... 27 2.6 SPACUNK4.17 |||NAD binding dehydrogenase family protein|Schizosa... 27 3.5 SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyce... 27 3.5 SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosacch... 26 4.6 SPAC1F5.08c |yam8|ehs1|calcium transport protein|Schizosaccharom... 26 4.6 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 29.1 bits (62), Expect = 0.65 Identities = 12/48 (25%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 174 EMYSEENKTFFVFRHXYNFPASLILTVTFYVQKAVEIF-NLKSDSNSV 34 ++++ TFF + H Y++ A+ + T F +F NL+++S+ + Sbjct: 413 QVFATAKVTFFQYLHDYSYIATFVFTYVFQALMLGSLFYNLRNESSEL 460 >SPBC1198.01 |||glutathione-dependent formaldehyde dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 423 Score = 27.1 bits (57), Expect = 2.6 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +3 Query: 381 SMRIISRSGDQVSSAEIGENLVLQVDV 461 S I++ GD+V++ EIG+ +V+ D+ Sbjct: 99 SCGIVAEKGDEVNNLEIGDRVVIAFDL 125 >SPACUNK4.17 |||NAD binding dehydrogenase family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 405 Score = 26.6 bits (56), Expect = 3.5 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 6/68 (8%) Frame = +1 Query: 10 DIQVECLADGVRVRLKIKDFNGLLYVKSYSKDERCRKVVXMPKDEESFVFFTVHF----- 174 D +E ADG +R+ +LYV+S DE KV P D+ + F + Sbjct: 320 DTCIEVQADGYYLRIVDLYEEPVLYVRSPDSDE--EKVYKYPNDDPYYSEFKIFLDAAEG 377 Query: 175 -GDCGLVH 195 GD L+H Sbjct: 378 KGDKNLIH 385 >SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 26.6 bits (56), Expect = 3.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 337 VNMDTLNARVTFCSPVLYMHLMWNAFVVML 248 + D + R+ + SPVL + WN VV++ Sbjct: 74 IKRDIVLCRIFYPSPVLSVRFTWNRLVVLI 103 >SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosaccharomyces pombe|chr 2|||Manual Length = 948 Score = 26.2 bits (55), Expect = 4.6 Identities = 16/63 (25%), Positives = 25/63 (39%) Frame = +3 Query: 291 TGEQNVTLAFNVSMLTTAGTIANTGPPPTCSMRIISRSGDQVSSAEIGENLVLQVDVQPS 470 +G T + TTAGT+ P PT S Q ++ V+ D+ PS Sbjct: 769 SGSVGFTTTIATPVGTTAGTVLIDVPTPTASSSPFPSCNTQCTNENSFRIQVINDDIYPS 828 Query: 471 SIY 479 ++ Sbjct: 829 YVH 831 >SPAC1F5.08c |yam8|ehs1|calcium transport protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 486 Score = 26.2 bits (55), Expect = 4.6 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = -1 Query: 186 AAISEMYSEENKTFFVFRHXYNFPASLILTVTFYVQKAVEIFNLKSDSNSVSQTFD 19 A I +S+ N T F+F +F A+L++T + I + + N + T+D Sbjct: 150 AGIDTPFSQYNATKFLFAQDTDFQAALLITGNLTTNETSIIPSYEIYVNPSNSTYD 205 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,817,746 Number of Sequences: 5004 Number of extensions: 56298 Number of successful extensions: 163 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -