BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30271 (705 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0366 + 22744584-22744835,22745248-22745335,22745657-227457... 31 1.2 11_06_0363 + 22724802-22725053,22725466-22725553,22725875-227259... 31 1.2 07_01_0067 + 490614-490796,491194-491358 30 2.1 01_01_0208 + 1780275-1781123 30 2.1 05_04_0298 + 19954904-19954985,19955075-19955888,19955962-19956922 28 6.3 03_02_0694 - 10448712-10448996,10449030-10449074,10449588-104496... 28 8.3 >11_06_0366 + 22744584-22744835,22745248-22745335,22745657-22745702, 22746159-22746345,22746436-22746507,22746597-22746728 Length = 258 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +2 Query: 599 ERSEDGSALRAAFNAFKFPSSDN---IRFQCNIRVCFG 703 E E AL AA FK PSS+N I CN R C G Sbjct: 134 ESKERSEALSAAAKKFKLPSSENLGEIAEHCNERKCAG 171 >11_06_0363 + 22724802-22725053,22725466-22725553,22725875-22725920, 22726377-22726563,22726654-22726725,22726815-22726946 Length = 258 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +2 Query: 599 ERSEDGSALRAAFNAFKFPSSDN---IRFQCNIRVCFG 703 E E AL AA FK PSS+N I CN R C G Sbjct: 134 ESKERSEALSAAAKKFKLPSSENLGEIAEHCNERKCAG 171 >07_01_0067 + 490614-490796,491194-491358 Length = 115 Score = 29.9 bits (64), Expect = 2.1 Identities = 24/96 (25%), Positives = 40/96 (41%), Gaps = 9/96 (9%) Frame = +1 Query: 28 LADGVRVRLKIKDFNGLLYVKSYSKDERCRKVVXMPKDEESFVFFTVHFGD-------CG 186 L D V + + + ++ S S+D K+ +PKD S V + + CG Sbjct: 12 LLDNFAVGMSLDEIGTIVINNSISRDRPSLKIRGVPKDVRSCDVERVRYKEQLSTRVGCG 71 Query: 187 LVH--VNGLASFVLVMQTHLKLVTSPQKHSTSNAYT 288 VH V + +V+ +L T HST + +T Sbjct: 72 RVHRIVENVLDKCIVVAPNLPTKTDNLSHSTGHGWT 107 >01_01_0208 + 1780275-1781123 Length = 282 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -3 Query: 661 TTGELESIESGTQRAAVLASFPFTENSGVLSTTVIVCY 548 T GEL + T + + P NS +++ T I CY Sbjct: 245 TIGELSRADQSTVTSTIRQEIPEASNSSIITITTISCY 282 >05_04_0298 + 19954904-19954985,19955075-19955888,19955962-19956922 Length = 618 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +3 Query: 309 TLAFNVSM--LTTAGTIANTGPPPTCSMRIISRSGDQVSSAEIGENLVLQVDVQPSSIYG 482 ++A+ + M LT + + + PPP C ++ +G+ A + LVL + + +S+ Sbjct: 95 SVAYQLGMVGLTVSALVPSLRPPP-CRGEAVAVAGEACQRATPWQLLVLYLSLLCTSVGT 153 Query: 483 GFARSCV 503 G R CV Sbjct: 154 GGTRPCV 160 >03_02_0694 - 10448712-10448996,10449030-10449074,10449588-10449647, 10449817-10449890,10451056-10451149,10451851-10452023, 10452526-10452598 Length = 267 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -3 Query: 589 ENSGVLSTTVIVCYKILIFYVS 524 +++G +STTV +C I++FY + Sbjct: 134 QSNGTISTTVFLCASIVLFYTN 155 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,330,813 Number of Sequences: 37544 Number of extensions: 371288 Number of successful extensions: 912 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 910 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -