BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30271 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49370| Best HMM Match : rve (HMM E-Value=0.0062) 31 0.91 SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 30 1.6 SB_23538| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) 29 4.9 SB_15193| Best HMM Match : rve (HMM E-Value=0.00021) 29 4.9 SB_47039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_32741| Best HMM Match : Filament (HMM E-Value=0.39) 28 8.5 >SB_49370| Best HMM Match : rve (HMM E-Value=0.0062) Length = 192 Score = 31.1 bits (67), Expect = 0.91 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = -3 Query: 436 SPISAELTWSPEREIILMEQVGGGPVLAIVPAVVNMDTLNARV 308 +P++ + EREI+ ++ + GGPV + PAV + LNAR+ Sbjct: 91 NPVAEKAVQELEREILQLDPL-GGPVSEVAPAVATAN-LNARI 131 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/61 (32%), Positives = 26/61 (42%) Frame = +1 Query: 13 IQVECLADGVRVRLKIKDFNGLLYVKSYSKDERCRKVVXMPKDEESFVFFTVHFGDCGLV 192 I+V C + VRL ++ F L D C+ VV E+ VFF V CG Sbjct: 412 IKVICSKHDMEVRLYMEYFERLSIDSLRLSDRACKPVVT----NETLVFFKVPLDGCGTA 467 Query: 193 H 195 H Sbjct: 468 H 468 >SB_23538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 475 ILDGWTSTCKTRFSPISAELTWSPEREIILMEQVGGGP 362 +L ++TCK F A +TW E+ M VGG P Sbjct: 187 VLXNSSTTCKYHFQTEQAPVTWKTVMEMRRMMAVGGRP 224 >SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) Length = 635 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +3 Query: 294 GEQNVTLAFNVSMLTTAGTIANTGPPPTCSMRIISRSGDQVSSAE--IGENLVLQVDVQP 467 G+ N + F + TT + PP+ +RII+ G SS+ + N+ + +VQ Sbjct: 418 GDPNAAITFE-EICTTINPLLEEHFPPSSGVRIIAEPGRYYSSSSFTLAVNVYSRREVQS 476 Query: 468 SSI 476 SS+ Sbjct: 477 SSV 479 >SB_15193| Best HMM Match : rve (HMM E-Value=0.00021) Length = 544 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = -3 Query: 436 SPISAELTWSPEREIILMEQVGGGPVLAIVPAVVNMDTLNARV 308 +P++ + EREI+ ++ + GGPV + AVV + LNAR+ Sbjct: 397 NPVAEKAVQELEREILQLDPL-GGPVSEVALAVVTAN-LNARI 437 >SB_47039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 154 VFFTVHFGDCGLVHVNGLASF 216 V+ VHF CG++ VNG A F Sbjct: 354 VYGNVHFSTCGMMPVNGNAHF 374 >SB_32741| Best HMM Match : Filament (HMM E-Value=0.39) Length = 1814 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +1 Query: 106 ERCRKVVXMPKDEESFVFFTVHF-GDCGLVHVNGLASFVLVMQTHLK 243 +RC+K + +E+ +F +F GD L+ + G A+ V+Q+HLK Sbjct: 1417 QRCQKSLNEFLEEKRSLFPRFYFIGDDDLLEILGQATNPTVIQSHLK 1463 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,412,710 Number of Sequences: 59808 Number of extensions: 437098 Number of successful extensions: 1188 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1186 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -