BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30271 (705 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC035609-1|AAH35609.1| 1195|Homo sapiens myotubularin related pr... 30 9.3 AF264717-1|AAF72539.1| 1195|Homo sapiens FYVE domain-containing ... 30 9.3 AB014547-1|BAA31622.2| 1195|Homo sapiens KIAA0647 protein protein. 30 9.3 >BC035609-1|AAH35609.1| 1195|Homo sapiens myotubularin related protein 4 protein. Length = 1195 Score = 29.9 bits (64), Expect = 9.3 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +3 Query: 159 LHCTFRRLRPCSCQWLSKLRSSNANSSETGNITTKAFHIKCIYKTGEQNVT 311 + C F + C +WLS+L + A ++ ++ A+H C+ T E T Sbjct: 97 VRCHFSTFKQCQ-EWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHT 146 >AF264717-1|AAF72539.1| 1195|Homo sapiens FYVE domain-containing dual specificity protein phosphatase FYVE-DSP2 protein. Length = 1195 Score = 29.9 bits (64), Expect = 9.3 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +3 Query: 159 LHCTFRRLRPCSCQWLSKLRSSNANSSETGNITTKAFHIKCIYKTGEQNVT 311 + C F + C +WLS+L + A ++ ++ A+H C+ T E T Sbjct: 97 VRCHFSTFKQCQ-EWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHT 146 >AB014547-1|BAA31622.2| 1195|Homo sapiens KIAA0647 protein protein. Length = 1195 Score = 29.9 bits (64), Expect = 9.3 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +3 Query: 159 LHCTFRRLRPCSCQWLSKLRSSNANSSETGNITTKAFHIKCIYKTGEQNVT 311 + C F + C +WLS+L + A ++ ++ A+H C+ T E T Sbjct: 97 VRCHFSTFKQCQ-EWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHT 146 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,227,437 Number of Sequences: 237096 Number of extensions: 2062955 Number of successful extensions: 12917 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12917 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -