BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30271 (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 24 1.6 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 4.9 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 4.9 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 6.5 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 8.6 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 8.6 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 8.6 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 2 QHQIFRSNVWLTELESDLRLK 64 ++QI +SNVWL + +D +L+ Sbjct: 69 KNQIMKSNVWLRFIWTDYQLQ 89 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 183 RPCSCQWLSKLRSSNANSSETGNITTKAFHIKC 281 +P C++ SK S N S I TK KC Sbjct: 118 KPYQCEYCSKSFSVKENLSVHRRIHTKERPYKC 150 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.2 bits (45), Expect = 4.9 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +2 Query: 251 HHHKSIP--HQMHIQNW*TKRNSCIQCVHVNNSRHNRQYRPSAYLLHEN 391 H+ + P H M + + R+ I H + H Y+ S YL++EN Sbjct: 45 HYERFSPSTHLMDLSSPPEHRDLPIYQSHHHLHHHQVLYQQSPYLMYEN 93 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 302 KRNSCIQCVHVNNSRHNRQ 358 +RNSC+ S+HN Q Sbjct: 375 RRNSCLGSTETYYSKHNTQ 393 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 6.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 288 KTGEQNVTLAFNVSMLTTAGTIANT 362 K Q++T NVS LTT T N+ Sbjct: 711 KESTQSLTTTGNVSYLTTNNTSNNS 735 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 360 YWRLCLLLL 334 YW LC+LLL Sbjct: 90 YWDLCMLLL 98 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 360 YWRLCLLLL 334 YW LC+LLL Sbjct: 90 YWDLCMLLL 98 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 360 YWRLCLLLL 334 YW LC+LLL Sbjct: 90 YWDLCMLLL 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,611 Number of Sequences: 438 Number of extensions: 3864 Number of successful extensions: 17 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -