BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30271 (705 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g52750.1 68414.m05963 hydrolase, alpha/beta fold family prote... 28 5.2 At4g25315.1 68417.m03641 Expressed protein 28 6.9 At3g47530.1 68416.m05169 pentatricopeptide (PPR) repeat-containi... 27 9.2 >At1g52750.1 68414.m05963 hydrolase, alpha/beta fold family protein contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 633 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -3 Query: 487 KPP*ILDGWTSTCKTRFSPISAELTWSPEREIILMEQVGGGPVLAIVPA 341 K P L+ W S +S E+ SP+ L++ +G PVL + A Sbjct: 528 KAPLCLEAWDEALN-EISKLSYEMILSPQNASALVKSIGDLPVLVVAGA 575 >At4g25315.1 68417.m03641 Expressed protein Length = 127 Score = 27.9 bits (59), Expect = 6.9 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 195 CQWLSKLRSSNANSSETGNITTKAFHIKCIYKTGE 299 C W+S+ + +N +TGN + ++ Y+ G+ Sbjct: 27 CYWMSRWSNITSNGDDTGNDLAPFYQMQQYYRVGK 61 >At3g47530.1 68416.m05169 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 591 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 195 CQWLSKLRSSNANSSETGNITTKAFHIKCIYKTGE 299 C+ RS NSS N + +F +KC K+G+ Sbjct: 94 CEGFRLFRSLRRNSSLPANPLSSSFALKCCIKSGD 128 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,748,684 Number of Sequences: 28952 Number of extensions: 298223 Number of successful extensions: 838 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -