BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30269 (491 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 107 2e-25 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 3.2 AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 22 9.9 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 22 9.9 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 107 bits (258), Expect = 2e-25 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 3/100 (3%) Frame = +1 Query: 1 ADQTE-KAFQKQATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTGNV 177 ADQ +AFQKQ + LNRK ++K +R H ++GLGFKTP+EAI GTYIDKKCPFTG++ Sbjct: 2 ADQQNIRAFQKQLGINLNRKNVSRKKGLRMHHSIGLGFKTPKEAITGTYIDKKCPFTGHI 61 Query: 178 SIXGRILTGVVQKMKMQRTIVIRRDY--FTTYPNTIGSRN 291 SI GRILTGVV+K + + IRRDY F +T RN Sbjct: 62 SIRGRILTGVVRKCIV--LLYIRRDYLQFIRKYDTFEKRN 99 Score = 94.7 bits (225), Expect = 2e-21 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = +3 Query: 255 LHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLK 410 L ++ KY+ FEKR+RNM +HLSPCFRDVE GDIVT+GECRPLSKTVRFNVLK Sbjct: 86 LQFIRKYDTFEKRNRNMRLHLSPCFRDVEAGDIVTLGECRPLSKTVRFNVLK 137 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 3.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 201 GEDAAXDRNVTSEGTLLVNVGT 136 GED D+ S+GTLL +GT Sbjct: 1268 GEDDTGDKKTDSDGTLL-EIGT 1288 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +3 Query: 78 HASP*ECWFRLQNSQRGD*GYLH 146 H P EC + +S GYLH Sbjct: 82 HYEPMECHSAVNSSSNSSTGYLH 104 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 73 SSSCHLSCSGKRWPVS 26 +SSC L +G RW VS Sbjct: 447 ASSCFLPEAGARWDVS 462 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 489,056 Number of Sequences: 2352 Number of extensions: 9868 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -