BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30268 (803 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0521 - 22904656-22904962,22905132-22905340,22905432-229055... 36 0.038 01_03_0262 - 14387045-14387187,14387334-14387420,14387439-14387496 29 5.7 05_06_0213 + 26414613-26414695,26416907-26417077,26417983-264182... 28 7.6 02_05_0468 + 29287867-29287872,29289114-29289156,29289324-292894... 28 7.6 01_03_0103 - 12567986-12568141,12568307-12568442,12568751-125688... 28 7.6 09_02_0022 + 3065644-3065953,3066048-3067162,3067261-3067437,306... 28 10.0 05_03_0373 - 13194723-13195847,13196219-13196809 28 10.0 >01_05_0521 - 22904656-22904962,22905132-22905340,22905432-22905521, 22905624-22905734,22906401-22906468,22906611-22906653 Length = 275 Score = 35.9 bits (79), Expect = 0.038 Identities = 24/66 (36%), Positives = 31/66 (46%) Frame = +3 Query: 90 MAPPYYADLGKKANDVFSKGYHFGVFKLDLKTKSESGVEFTSGITSNQESGKVFGAFPPN 269 MAP Y D+GKK D+ + Y K L T + GV T+ T ES VFG Sbjct: 1 MAPGLYTDIGKKTRDLLYRDYGTH-HKFTLTTCTPEGVTITAAGTRKNES--VFGELQTQ 57 Query: 270 LQ*KTM 287 L+ K + Sbjct: 58 LKNKKL 63 Score = 27.9 bits (59), Expect = 10.0 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 538 GVHTQFDTQKAKFSKNNFALGYQSGDF--ALHTNVDNGKDFGGSIYQKV 678 GV FDT + F+K N AL + D +LH N ++G S Y V Sbjct: 142 GVDVAFDTATSNFTKYNAALSLTNSDLIASLHLN-NHGDTLIASYYHLV 189 >01_03_0262 - 14387045-14387187,14387334-14387420,14387439-14387496 Length = 95 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 790 LGVQRRVLVRAYFAPTPNNVSAEPAVHFM*RRSP 689 + + +VLV+ +F+ T NN++AE H +SP Sbjct: 43 IALYEKVLVKYFFSSTTNNLTAEKKFHHFCFQSP 76 >05_06_0213 + 26414613-26414695,26416907-26417077,26417983-26418219, 26418543-26418572,26419248-26419282,26421680-26421747, 26423067-26423126,26423310-26423399,26423487-26423695, 26424083-26424383 Length = 427 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +1 Query: 538 GVHTQFDTQKAKFSKNNFALGYQSGDFALHTNVDN-GKDFGGSIYQKVS 681 G FDT F+K N L + + D ++N G S Y KVS Sbjct: 296 GTDVAFDTATGDFTKYNAGLSHTTPDLTAALLLNNKGDSLAASYYHKVS 344 >02_05_0468 + 29287867-29287872,29289114-29289156,29289324-29289450, 29289615-29289703,29289794-29289854,29289944-29290011, 29290099-29290227,29291020-29291126,29291210-29291557, 29291803-29291883,29291905-29291952,29292331-29292496, 29292609-29292652 Length = 438 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 593 AKLFLENLAFCVSNWVCT 540 A L + NL+ C SNW CT Sbjct: 99 AGLIIRNLSICTSNWRCT 116 >01_03_0103 - 12567986-12568141,12568307-12568442,12568751-12568824, 12568932-12569175,12569480-12569766,12570618-12571103, 12571348-12571459,12571540-12571745,12573071-12573276, 12573831-12574162,12574284-12574825,12574967-12576308, 12576386-12576457,12578438-12578505,12579011-12580174 Length = 1808 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 181 RPRASLVLNSPAGSPPTRKAERFLAPFLQICSER 282 RP A +L S P R A FLAP IC+ R Sbjct: 1064 RPLAKHLLESQYFPPSVRSAYMFLAPLQLICTPR 1097 >09_02_0022 + 3065644-3065953,3066048-3067162,3067261-3067437, 3067535-3067648,3068614-3068718,3068930-3069064, 3069148-3069203,3069277-3069382,3069515-3069631, 3069705-3069831,3069915-3070141,3070164-3070727 Length = 1050 Score = 27.9 bits (59), Expect = 10.0 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 438 NEVFNFPVL-VPVCGAKVPSRVTLRPAAILSWIVMSVANVLSVF 310 ++V + VL + C + SR+ L PA+ LSW S LS F Sbjct: 606 DQVLDVKVLKISECAQSLSSRLVLTPASKLSWFGFSENGELSSF 649 >05_03_0373 - 13194723-13195847,13196219-13196809 Length = 571 Score = 27.9 bits (59), Expect = 10.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 386 GTFAPQTGTKTGKLKTSFTNDTVAVNTNLDLDL 484 GT+ Q T TGK+ +FT + + LDLD+ Sbjct: 537 GTYVAQVTTATGKMLKTFTVEKGDNSLELDLDI 569 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,708,477 Number of Sequences: 37544 Number of extensions: 482085 Number of successful extensions: 1197 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1197 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2185924824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -