BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30266 (685 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0479 + 3606663-3607448 79 4e-15 01_06_1461 - 37520885-37520965,37521366-37521461,37522160-37522297 36 0.030 06_03_1120 - 27765613-27765963 33 0.21 03_04_0043 + 16747103-16747137,16747237-16747259,16748735-167488... 32 0.49 05_07_0342 + 29402867-29402906,29403012-29403052,29403146-294032... 31 0.64 08_01_0328 + 2959014-2959055,2959336-2959398,2960871-2960949,296... 31 0.85 05_03_0462 - 14316486-14316602,14316689-14316793,14318406-143184... 30 1.5 02_04_0280 - 21548920-21549032,21549379-21549397,21549555-21550619 30 1.5 05_04_0169 - 18694418-18694453,18694516-18694627,18696095-186962... 30 2.0 01_07_0305 - 42631214-42631330,42631423-42631527,42633208-426332... 30 2.0 03_02_0337 + 7594259-7594319,7594455-7595205,7596323-7596509 29 2.6 02_05_0887 + 32516255-32517292 29 4.5 02_01_0209 - 1399613-1399622,1399719-1399764,1399849-1399927,140... 28 6.0 >07_01_0479 + 3606663-3607448 Length = 261 Score = 78.6 bits (185), Expect = 4e-15 Identities = 37/79 (46%), Positives = 53/79 (67%), Gaps = 3/79 (3%) Frame = +1 Query: 88 MTIGKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKI---KSKNRK 258 M+ K +KM Q +NYR+RV +QD R +G F AFD+HMNL+LGDCEEFRK+ KS Sbjct: 1 MSNPKGSKMLQFVNYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPSKSSKTT 60 Query: 259 LQTEKKKELWVLFFYVEKI 315 + E+++ L +L E++ Sbjct: 61 GEREERRTLGLLLLRGEEV 79 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/25 (64%), Positives = 22/25 (88%) Frame = +3 Query: 258 TADREEKRTLGFVLLRGENIVSLTI 332 T +REE+RTLG +LLRGE +VS+T+ Sbjct: 60 TGEREERRTLGLLLLRGEEVVSMTV 84 >01_06_1461 - 37520885-37520965,37521366-37521461,37522160-37522297 Length = 104 Score = 35.9 bits (79), Expect = 0.030 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +1 Query: 124 INYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 228 ++ R+ V L+ R G A+D+H+N+ILGD EE Sbjct: 27 LDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEE 61 >06_03_1120 - 27765613-27765963 Length = 116 Score = 33.1 bits (72), Expect = 0.21 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +1 Query: 109 KMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFR 234 K+++ + R+ V + D R F+G F DK N++L D E+R Sbjct: 24 KLRKMLFRRMLVGVNDGRYFLGLFHCVDKQGNILLQDAVEYR 65 >03_04_0043 + 16747103-16747137,16747237-16747259,16748735-16748856, 16748980-16749042 Length = 80 Score = 31.9 bits (69), Expect = 0.49 Identities = 11/44 (25%), Positives = 29/44 (65%) Frame = +1 Query: 97 GKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 228 G+ ++++++ ++++ L +R +GT + FD+ MNL++ + E Sbjct: 5 GQPPDLKKYMDKKLQIKLNANRVIVGTLRGFDQFMNLVVDNTVE 48 >05_07_0342 + 29402867-29402906,29403012-29403052,29403146-29403220, 29403523-29403648,29404195-29404247,29404385-29404475 Length = 141 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 112 MQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 228 ++ ++ + VI D R +GT + FD+ N+IL + E Sbjct: 8 LESLVDQIISVITNDGRNIVGTLRGFDQATNIILDESHE 46 >08_01_0328 + 2959014-2959055,2959336-2959398,2960871-2960949, 2961038-2961083,2961566-2961671 Length = 111 Score = 31.1 bits (67), Expect = 0.85 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +1 Query: 112 MQQHINYRVRVIL--QDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRK 258 M Q I R+++ L Q G FD++MNL+L D EE +K RK Sbjct: 10 MTQPIKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEI-NVKKDTRK 59 >05_03_0462 - 14316486-14316602,14316689-14316793,14318406-14318486, 14318593-14318610 Length = 106 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = +1 Query: 127 NYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRKLQTEKKKEL 285 N +V + ++++ +G +AFD+H N++L E R++ ++ K KKK L Sbjct: 31 NTQVLINCRNNKKLLGRVRAFDRHCNMVL---ENVREMWTEVPKTGKGKKKAL 80 >02_04_0280 - 21548920-21549032,21549379-21549397,21549555-21550619 Length = 398 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 115 QQHINYRVRVILQDSRTFIGTFKAFDKHMN 204 +Q++N + R + D +FIG++K KH+N Sbjct: 152 RQYLNRKKRACMHDGCSFIGSYKELCKHVN 181 >05_04_0169 - 18694418-18694453,18694516-18694627,18696095-18696243, 18696980-18697033,18697110-18697222,18697323-18697374 Length = 171 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 124 INYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEF 231 I ++ VI++ + +GT FD ++N++L D E+ Sbjct: 88 IGSKIWVIMKGDKELVGTLCGFDVYVNMVLEDVTEY 123 >01_07_0305 - 42631214-42631330,42631423-42631527,42633208-42633216, 42635198-42636142,42636349-42636450,42637210-42637302 Length = 456 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +1 Query: 133 RVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRKLQTEKKKEL 285 +V + Q+++ +G +AFD H N++L E R++ ++ K KKK L Sbjct: 383 KVLINCQNNKKLLGRVRAFDSHCNMVL---ENVREMWTEVPKTGKGKKKAL 430 >03_02_0337 + 7594259-7594319,7594455-7595205,7596323-7596509 Length = 332 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 564 ASSRNDGSSSWHGSLWARTGSSRNAT 641 AS+ D +SW G +WART + +AT Sbjct: 61 ASATVDAPASWSGRMWARTLCAEDAT 86 >02_05_0887 + 32516255-32517292 Length = 345 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +1 Query: 115 QQHINYRVRVILQDSRTFIGTFKAFDKHM 201 + ++N + R +QD +F+GT+K KH+ Sbjct: 149 RSYLNGKRRTCMQDGCSFVGTYKELRKHV 177 >02_01_0209 - 1399613-1399622,1399719-1399764,1399849-1399927, 1400004-1400162,1400988-1401050,1401154-1401222 Length = 141 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 181 KAFDKHMNLILGDCEEFRKIKSKNRK 258 K FD++MNL+L + EE IK RK Sbjct: 97 KGFDEYMNLVLDEAEEI-NIKKDTRK 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,680,297 Number of Sequences: 37544 Number of extensions: 213796 Number of successful extensions: 726 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -