BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30266 (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12681| Best HMM Match : LSM (HMM E-Value=5.7e-18) 98 7e-21 SB_2028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26035| Best HMM Match : LSM (HMM E-Value=6.1e-13) 33 0.22 SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13) 31 0.66 SB_18906| Best HMM Match : LSM (HMM E-Value=3.2e-15) 29 2.7 SB_25863| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_18527| Best HMM Match : LSM (HMM E-Value=1.3) 29 4.6 SB_49489| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_12681| Best HMM Match : LSM (HMM E-Value=5.7e-18) Length = 327 Score = 97.9 bits (233), Expect = 7e-21 Identities = 44/67 (65%), Positives = 53/67 (79%) Frame = +1 Query: 85 KMTIGKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRKLQ 264 K TIGK++KM HINYR+R LQD R FIGTF AFDKHMN+ILGDC+EFRKIK K+ K Q Sbjct: 23 KPTIGKSSKMLLHINYRMRCTLQDGRVFIGTFLAFDKHMNVILGDCDEFRKIKGKSSKAQ 82 Query: 265 TEKKKEL 285 ++K + Sbjct: 83 EREEKRV 89 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = +3 Query: 255 KTADREEKRTLGFVLLRGENIVSLTI 332 K +REEKR LG VLLRGE++VS+T+ Sbjct: 80 KAQEREEKRVLGLVLLRGEHLVSMTV 105 >SB_2028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 100 KNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEF 231 + +++ +N +RV + D RT IG+F DK N+ILG C+EF Sbjct: 29 QRKELESWLNKLMRVKISDGRTLIGSFLCTDKDRNIILGSCQEF 72 >SB_26035| Best HMM Match : LSM (HMM E-Value=6.1e-13) Length = 75 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +1 Query: 124 INYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 228 ++ R+ V +++ R G A+D+H+N+IL D EE Sbjct: 24 LDERIYVKMRNDRELRGRLHAYDQHLNMILSDVEE 58 >SB_36609| Best HMM Match : Ion_trans_2 (HMM E-Value=1.7e-13) Length = 661 Score = 31.5 bits (68), Expect = 0.66 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +1 Query: 100 KNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRKLQTEKK- 276 ++ +M +H YR + L+DS F + NL L CE + +++ +++L KK Sbjct: 485 RHQRMMRHNQYRELLGLRDSLDFSSNMEDSHATQNLRLSTCELTKSLRNFSKELPFIKKG 544 Query: 277 -KELWV-LFFY 303 E + LFFY Sbjct: 545 HAETQINLFFY 555 >SB_18906| Best HMM Match : LSM (HMM E-Value=3.2e-15) Length = 443 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +1 Query: 127 NYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRKLQTEKK 276 N +V + +++R + KAFD+H N++L + +E K+ K + + K Sbjct: 29 NTQVLINCRNNRKLLARVKAFDRHCNMVLENVKEMWTETPKSGKGKKKAK 78 >SB_25863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +1 Query: 64 YLPNHSDKMTIGKNNKMQQHINY--RVRVILQDSR 162 ++P H+ M IGK +M + I + RVR I+ SR Sbjct: 334 FIPEHAMGMVIGKKGRMLEEIKHKTRVRPIIDKSR 368 >SB_18527| Best HMM Match : LSM (HMM E-Value=1.3) Length = 198 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 175 TFKAFDKHMNLILGDCEEFRKIKSKNRK 258 T FD++MNL+L + EE +K+K RK Sbjct: 121 TTHGFDEYMNLVLDEAEEVH-LKTKTRK 147 >SB_49489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 118 VASYCFCRSSFYRSD*EDITRYLESFNLLQRYSLDSC 8 V ++ FC SF RSD ++ R+L + +R+ D C Sbjct: 373 VCNWLFCGKSFTRSD--ELQRHLRTHTGEKRFQCDEC 407 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,098,087 Number of Sequences: 59808 Number of extensions: 257036 Number of successful extensions: 638 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -