BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30266 (685 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 83 2e-16 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 82 3e-16 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 82 3e-16 At1g21190.1 68414.m02649 small nuclear ribonucleoprotein, putati... 38 0.008 At1g76860.1 68414.m08944 small nuclear ribonucleoprotein, putati... 37 0.011 At4g18372.1 68417.m02725 small nuclear ribonucleoprotein-related... 35 0.058 At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putati... 33 0.18 At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putati... 33 0.18 At3g62840.1 68416.m07060 small nuclear ribonucleoprotein D2, put... 31 0.54 At2g47640.3 68415.m05946 small nuclear ribonucleoprotein D2, put... 31 0.54 At2g47640.2 68415.m05945 small nuclear ribonucleoprotein D2, put... 31 0.54 At2g47640.1 68415.m05944 small nuclear ribonucleoprotein D2, put... 31 0.54 At1g77770.2 68414.m09056 expressed protein 31 0.54 At1g77770.1 68414.m09055 expressed protein 31 0.54 At3g11500.1 68416.m01402 small nuclear ribonucleoprotein G, puta... 31 0.71 At4g30330.1 68417.m04311 small nuclear ribonucleoprotein E, puta... 30 1.2 At1g65700.1 68414.m07457 small nuclear ribonucleoprotein, putati... 30 1.2 At2g23930.1 68415.m02857 small nuclear ribonucleoprotein G, puta... 29 2.2 At1g68140.1 68414.m07783 expressed protein 29 3.8 At2g18740.1 68415.m02182 small nuclear ribonucleoprotein E, puta... 28 5.0 At1g61190.1 68414.m06895 disease resistance protein (CC-NBS-LRR ... 27 8.8 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 82.6 bits (195), Expect = 2e-16 Identities = 37/66 (56%), Positives = 50/66 (75%), Gaps = 1/66 (1%) Frame = +1 Query: 88 MTIGKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKI-KSKNRKLQ 264 M++ K++KM Q INYR+RV +QD R IG F AFD+HMNL+LGDCEEFRK+ +K K Sbjct: 1 MSMSKSSKMLQFINYRMRVTIQDGRQLIGKFMAFDRHMNLVLGDCEEFRKLPPAKGNKKT 60 Query: 265 TEKKKE 282 E+++E Sbjct: 61 NEEREE 66 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = +3 Query: 264 DREEKRTLGFVLLRGENIVSLTI 332 +REE+RTLG VLLRGE ++S+T+ Sbjct: 63 EREERRTLGLVLLRGEEVISMTV 85 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 82.2 bits (194), Expect = 3e-16 Identities = 35/64 (54%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 88 MTIGKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKI-KSKNRKLQ 264 M++ K++KM Q INYR+RV +QD R +G F AFD+HMNL+LGDCEEFRK+ +K +K+ Sbjct: 1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKIN 60 Query: 265 TEKK 276 E++ Sbjct: 61 EERE 64 Score = 37.9 bits (84), Expect = 0.006 Identities = 14/23 (60%), Positives = 21/23 (91%) Frame = +3 Query: 264 DREEKRTLGFVLLRGENIVSLTI 332 +RE++RTLG VLLRGE ++S+T+ Sbjct: 62 EREDRRTLGLVLLRGEEVISMTV 84 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 82.2 bits (194), Expect = 3e-16 Identities = 35/64 (54%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 88 MTIGKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKI-KSKNRKLQ 264 M++ K++KM Q INYR+RV +QD R +G F AFD+HMNL+LGDCEEFRK+ +K +K+ Sbjct: 1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKIN 60 Query: 265 TEKK 276 E++ Sbjct: 61 EERE 64 Score = 37.9 bits (84), Expect = 0.006 Identities = 14/23 (60%), Positives = 21/23 (91%) Frame = +3 Query: 264 DREEKRTLGFVLLRGENIVSLTI 332 +RE++RTLG VLLRGE ++S+T+ Sbjct: 62 EREDRRTLGLVLLRGEEVISMTV 84 >At1g21190.1 68414.m02649 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9Y4Z1 U6 snRNA-associated Sm-like protein LSm3 (MDS017) [Mouse] Length = 97 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +1 Query: 124 INYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 228 I R+ V L+ R G AFD+H+N+ILGD EE Sbjct: 20 IEERIYVKLRSDRELRGKLHAFDQHLNMILGDVEE 54 >At1g76860.1 68414.m08944 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9Y4Z1 U6 snRNA-associated Sm-like protein LSm3 (MDS017) [Mouse] Length = 98 Score = 37.1 bits (82), Expect = 0.011 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +1 Query: 124 INYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 228 ++ R+ V L+ R G AFD+H+N+ILGD EE Sbjct: 20 LDERIYVKLRSDRELRGKLHAFDQHLNMILGDVEE 54 >At4g18372.1 68417.m02725 small nuclear ribonucleoprotein-related / snRNP-related contains similarity to snRNP-associated polypeptide N [Rattus norvegicus] GP|206694|gb|AAA42059 Length = 112 Score = 34.7 bits (76), Expect = 0.058 Identities = 15/46 (32%), Positives = 29/46 (63%) Frame = +1 Query: 106 NKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIK 243 +++++ + ++ V ++D R F+G F DK N+IL D E+R I+ Sbjct: 25 SRLRKLLFRQMLVGIKDGRFFLGNFHCIDKQGNIILQDTVEYRSIR 70 >At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/42 (30%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 103 NNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLIL-GDCE 225 + + +++ ++ V+L+D R +GT ++FD+ N +L G CE Sbjct: 12 STSLASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACE 53 >At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/42 (30%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 103 NNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLIL-GDCE 225 + + +++ ++ V+L+D R +GT ++FD+ N +L G CE Sbjct: 12 STSLASYLDRKLLVLLRDGRKLMGTLRSFDQFANAVLEGACE 53 >At3g62840.1 68416.m07060 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 31.5 bits (68), Expect = 0.54 Identities = 17/53 (32%), Positives = 31/53 (58%) Frame = +1 Query: 127 NYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRKLQTEKKKEL 285 N +V + +++R +G +AFD+H N++L E R++ ++ K KKK L Sbjct: 33 NTQVLINCRNNRKLLGRVRAFDRHCNMVL---ENVREMWTEVPKTGKGKKKAL 82 >At2g47640.3 68415.m05946 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 31.5 bits (68), Expect = 0.54 Identities = 17/53 (32%), Positives = 31/53 (58%) Frame = +1 Query: 127 NYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRKLQTEKKKEL 285 N +V + +++R +G +AFD+H N++L E R++ ++ K KKK L Sbjct: 33 NTQVLINCRNNRKLLGRVRAFDRHCNMVL---ENVREMWTEVPKTGKGKKKAL 82 >At2g47640.2 68415.m05945 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 31.5 bits (68), Expect = 0.54 Identities = 17/53 (32%), Positives = 31/53 (58%) Frame = +1 Query: 127 NYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRKLQTEKKKEL 285 N +V + +++R +G +AFD+H N++L E R++ ++ K KKK L Sbjct: 33 NTQVLINCRNNRKLLGRVRAFDRHCNMVL---ENVREMWTEVPKTGKGKKKAL 82 >At2g47640.1 68415.m05944 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 109 Score = 31.5 bits (68), Expect = 0.54 Identities = 17/53 (32%), Positives = 31/53 (58%) Frame = +1 Query: 127 NYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRKLQTEKKKEL 285 N +V + +++R +G +AFD+H N++L E R++ ++ K KKK L Sbjct: 34 NTQVLINCRNNRKLLGRVRAFDRHCNMVL---ENVREMWTEVPKTGKGKKKAL 83 >At1g77770.2 68414.m09056 expressed protein Length = 264 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 91 TIGKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHM 201 T+ K+ +M H N + R +QD+ +F+G F+ KHM Sbjct: 98 TVVKDARM--HFNSKRRTCMQDNCSFLGNFRKLKKHM 132 >At1g77770.1 68414.m09055 expressed protein Length = 265 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 91 TIGKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHM 201 T+ K+ +M H N + R +QD+ +F+G F+ KHM Sbjct: 98 TVVKDARM--HFNSKRRTCMQDNCSFLGNFRKLKKHM 132 >At3g11500.1 68416.m01402 small nuclear ribonucleoprotein G, putative / snRNP-G, putative / Sm protein G, putative similar to SWISS-PROT:Q15357 small nuclear ribonucleoprotein G (snRNP-G, Sm protein G, Sm-G, SmG) [Homo sapiens] Length = 79 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/44 (25%), Positives = 29/44 (65%) Frame = +1 Query: 97 GKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 228 G+ ++++++ ++++ L +R +GT + FD+ MNL++ + E Sbjct: 5 GQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVE 48 >At4g30330.1 68417.m04311 small nuclear ribonucleoprotein E, putative / snRNP-E, putative / Sm protein E, putative similar to SWISS-PROT:P08578 small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E, Sm-E, SmE) [Chicken] Length = 88 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +1 Query: 112 MQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRK 258 +Q ++ + Q G FD++MNL+L + EE IK K RK Sbjct: 21 LQSKARIQIWLFEQKDLRIEGRITGFDEYMNLVLDEAEEV-SIKKKTRK 68 >At1g65700.1 68414.m07457 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm8 [Homo sapiens] SWISS-PROT:O95777 Length = 98 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 136 VRVILQDSRTFIGTFKAFDKHMNLILGDCEE 228 + VI D R +G K FD+ N+IL + E Sbjct: 15 ISVITNDGRNIVGVLKGFDQATNIILDESHE 45 >At2g23930.1 68415.m02857 small nuclear ribonucleoprotein G, putative / snRNP-G, putative / Sm protein G, putative similar to small nuclear ribonucleoprotein G (snRNP-G, Sm protein G, Sm-G, SmG) [Homo sapiens] SWISS-PROT:Q15357 Length = 80 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/44 (25%), Positives = 28/44 (63%) Frame = +1 Query: 97 GKNNKMQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEE 228 G+ ++++++ ++++ L +R GT + FD+ MNL++ + E Sbjct: 5 GQPPDLKKYMDKKLQIKLNANRMVTGTLRGFDQFMNLVVDNTVE 48 >At1g68140.1 68414.m07783 expressed protein Length = 334 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 124 INYRVRVILQDSRTFIGTFKAFDKHMNL 207 +N + R+ +Q++ + GTFK KHM + Sbjct: 140 LNLKKRICMQENCVYAGTFKELRKHMKV 167 >At2g18740.1 68415.m02182 small nuclear ribonucleoprotein E, putative / snRNP-E, putative / Sm protein E, putative similar to SWISS-PROT:P08578 small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E, Sm-E, SmE) [Chicken] Length = 88 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +1 Query: 112 MQQHINYRVRVILQDSRTFIGTFKAFDKHMNLILGDCEEFRKIKSKNRK 258 +Q ++ + Q G FD++MNL+L + EE IK RK Sbjct: 21 LQSKARIQIWLFEQKDLRIEGRITGFDEYMNLVLDEAEEV-SIKKNTRK 68 >At1g61190.1 68414.m06895 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 967 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 312 FLHVKEQNPKFFF 274 FL+VK QNP+FFF Sbjct: 895 FLNVKNQNPRFFF 907 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,374,301 Number of Sequences: 28952 Number of extensions: 180993 Number of successful extensions: 567 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -