BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30265X (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 138 2e-33 SB_49454| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_8770| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_40812| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 40 9e-04 SB_21399| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_45563| Best HMM Match : TMS_TDE (HMM E-Value=2.2e-10) 29 2.8 SB_33629| Best HMM Match : Extensin_2 (HMM E-Value=2.2) 29 2.8 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 28 5.0 SB_45055| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) 28 5.0 SB_57560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 138 bits (334), Expect = 2e-33 Identities = 62/88 (70%), Positives = 71/88 (80%), Gaps = 1/88 (1%) Frame = -3 Query: 473 RLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAVDARWLA 294 R KGIGEYVN RTGMPCHLHPTSALFG+G +PDY+VYHEL MT++EYM CVTAVD WLA Sbjct: 1058 RRKGIGEYVNMRTGMPCHLHPTSALFGMGYTPDYIVYHELVMTSKEYMQCVTAVDGNWLA 1117 Query: 293 ELGPMFFSVKE-TGNRIETSVKKQRSTS 213 ELGPMF+SVKE T +R E + + S Sbjct: 1118 ELGPMFYSVKESTRSRAENRRRAKEEMS 1145 >SB_49454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 49.6 bits (113), Expect = 1e-06 Identities = 28/72 (38%), Positives = 37/72 (51%) Frame = -3 Query: 488 FQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAVD 309 F +A L+ G Y +HP+S+LF P YVVY+EL T++ YM V+ V Sbjct: 613 FMNSAELQLDGTYQTLNHRETVAIHPSSSLFM--SKPAYVVYNELVHTSKCYMRDVSVVS 670 Query: 308 ARWLAELGPMFF 273 WL E P FF Sbjct: 671 CDWLLEAAPGFF 682 >SB_8770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1303 Score = 44.4 bits (100), Expect = 5e-05 Identities = 23/60 (38%), Positives = 33/60 (55%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAV 312 +F+ AAR Y ++HP+SALF P++VVYHEL +T +EYM V + Sbjct: 856 FFRNAARKDPQEGYRTVVDNQVVYIHPSSALFNR--QPEWVVYHELVLTTKEYMREVVVM 913 >SB_40812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1168 Score = 44.0 bits (99), Expect = 7e-05 Identities = 21/57 (36%), Positives = 31/57 (54%) Frame = -3 Query: 452 YVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAVDARWLAELGP 282 Y+ P +HP SALF + P YVVY E+ T++ ++ VT ++ WL L P Sbjct: 958 YICTAVEEPVFIHPKSALFSV--LPQYVVYQEVVETSKLFLKGVTTIEVEWLPVLVP 1012 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 40.3 bits (90), Expect = 9e-04 Identities = 17/54 (31%), Positives = 30/54 (55%) Frame = -3 Query: 452 YVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAVDARWLAE 291 Y N G LHP+SA+ +G P ++VY + T ++++ VT ++ WL + Sbjct: 1267 YKNLYDGEYVQLHPSSAINFIGTEPKFLVYEKTLRTTQDFIINVTPIEEAWLLD 1320 >SB_21399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 273 EEHGPQLGQPARVHGGDAVHVLARRHGELVVHH 371 E+H QL +P G D++ AR HG VV H Sbjct: 236 EKHLEQLSKPGVYGGNDSIVAFARNHGADVVIH 268 >SB_45563| Best HMM Match : TMS_TDE (HMM E-Value=2.2e-10) Length = 246 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 368 PRSRGCSPARTAPRWGAGG 424 P + GCSP+R PR G GG Sbjct: 130 PDTEGCSPSRPHPRQGDGG 148 >SB_33629| Best HMM Match : Extensin_2 (HMM E-Value=2.2) Length = 958 Score = 28.7 bits (61), Expect = 2.8 Identities = 23/72 (31%), Positives = 30/72 (41%), Gaps = 3/72 (4%) Frame = +3 Query: 276 EHGPQLGQPARVHGGDAVHVLARRHGEL---VVHHVVGAAAQPEQRRGGVQVARHAGAAV 446 +HG Q A+ GG + A +HGE V H G Q + + G QV A A Sbjct: 595 KHGEQEEDVAKHAGGKDLQEKAHKHGEHVEDVAKHAGGKDLQEKAHKHGEQVEDVAKQAG 654 Query: 447 HVLADALQPRRL 482 + LQ R L Sbjct: 655 YPYQKKLQKRTL 666 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 392 ARTAPRWGAGGTACRCGSSRTRR 460 A+ A GAG ACRC SR +R Sbjct: 1067 AKEANEAGAGEKACRCAQSREKR 1089 >SB_45055| Best HMM Match : Ribosomal_60s (HMM E-Value=0.46) Length = 741 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 434 GMPCHLHPTSALFGLGCSP 378 G P H P SAL GLGC P Sbjct: 487 GTPPHSRPRSALPGLGCYP 505 >SB_57560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 6.6 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = -3 Query: 353 TMTAREYMHCVTAVDARWLAELGPMFFSVKETGNRIETSVKKQRSTS 213 T R Y + R LA+ P + +ET RIE S +K + S Sbjct: 85 TPAVRHYRRYERPLRTRQLAQTLPKILAKRETNARIEASTRKDKILS 131 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,178,898 Number of Sequences: 59808 Number of extensions: 212299 Number of successful extensions: 608 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -