BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30265X (502 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 2.5 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 4.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 4.4 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 5.8 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 5.8 AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskele... 23 5.8 AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskel... 23 5.8 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 24.2 bits (50), Expect = 2.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 486 PAGGAAEGHRRVRELPHR 433 P GAAE HRR R P R Sbjct: 325 PVPGAAERHRRRRPPPRR 342 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.4 bits (48), Expect = 4.4 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +2 Query: 356 ARGTPRSRGCSPARTAPRWGAGGTACRCGSSRTRRCPSAAPPAGSK 493 A G P G P+R + G + G+SR + P A PP K Sbjct: 178 ASGVP---GAEPSRGSTPPTPGDDSDSMGASRHGKTPLATPPTKEK 220 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 4.4 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 359 RGTPRSRGCSPARTAPRWGAGGTACRCGSSRTRRCPSAAP 478 R P SR +P R +PR G +CR +R RR S P Sbjct: 248 RKIPPSRR-NPRRRSPRSGGRWPSCRSPPAR-RRSRSTRP 285 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.0 bits (47), Expect = 5.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +3 Query: 336 LARRHGELVVHHVVGAAAQP--EQRRGGVQVA 425 L R G+L + GAAA+P ++R VQ++ Sbjct: 693 LVTRRGDLTIEIGTGAAARPRVDERLDAVQLS 724 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 5.8 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +3 Query: 336 LARRHGELVVHHVVGAAAQP--EQRRGGVQVA 425 L R G+L + GAAA+P ++R VQ++ Sbjct: 737 LVTRRGDLTIEIGTGAAARPRVDERLDAVQLS 768 >AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 23.0 bits (47), Expect = 5.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 262 SLTEKNMGPSSASQRASTAVTQCMYSRAVMVSS 360 S+ E+++G R S V QC + +VSS Sbjct: 72 SVNERSLGIKQRIDRLSAKVDQCDPKQVTVVSS 104 >AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 23.0 bits (47), Expect = 5.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 262 SLTEKNMGPSSASQRASTAVTQCMYSRAVMVSS 360 S+ E+++G R S V QC + +VSS Sbjct: 72 SVNERSLGIKQRIDRLSAKVDQCDPKQVTVVSS 104 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 407,469 Number of Sequences: 2352 Number of extensions: 7711 Number of successful extensions: 19 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -