BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30265X (502 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-... 146 1e-35 At3g26560.1 68416.m03315 ATP-dependent RNA helicase, putative si... 70 8e-13 At1g32490.1 68414.m04009 RNA helicase, putative similar to ATP-d... 63 9e-11 At4g16680.1 68417.m02519 RNA helicase, putative similar to SP|Q1... 62 2e-10 At2g35340.1 68415.m04333 RNA helicase, putative similar to ATP-d... 62 2e-10 At1g26370.1 68414.m03217 RNA helicase, putative similar to SP|Q1... 59 1e-09 At3g62310.1 68416.m07000 RNA helicase, putative similar to SP|P5... 55 2e-08 At2g47250.1 68415.m05900 RNA helicase, putative similar to SP|P5... 55 3e-08 At5g14900.1 68418.m01748 helicase associated (HA2) domain-contai... 52 2e-07 At4g18465.1 68417.m02740 RNA helicase, putative similar to SP|Q1... 52 2e-07 At1g27900.1 68414.m03419 RNA helicase, putative similar to SP|Q1... 45 3e-05 At1g33390.1 68414.m04133 helicase domain-containing protein simi... 44 6e-05 At5g10370.1 68418.m01203 helicase domain-containing protein / IB... 44 8e-05 At4g01020.1 68417.m00137 helicase domain-containing protein / IB... 41 4e-04 At1g78700.1 68414.m09173 brassinosteroid signalling positive reg... 29 1.8 At5g47210.1 68418.m05821 nuclear RNA-binding protein, putative s... 28 3.1 At5g18410.2 68418.m02167 expressed protein similar to p53 induci... 28 4.1 At5g18410.1 68418.m02166 expressed protein similar to p53 induci... 28 4.1 At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (AB... 27 5.4 At2g33360.1 68415.m04089 expressed protein 27 9.4 >At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-box RNA helicase [Chlamydomonas reinhardtii] GI:12044832; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1226 Score = 146 bits (353), Expect = 1e-35 Identities = 61/90 (67%), Positives = 74/90 (82%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAV 312 YF +ARLKG+GEYVNCRTGMPCHLHP+SAL+GLG +PDYVVYHEL +T +EYM C T+V Sbjct: 1079 YFHNSARLKGVGEYVNCRTGMPCHLHPSSALYGLGYTPDYVVYHELILTTKEYMQCATSV 1138 Query: 311 DARWLAELGPMFFSVKETGNRIETSVKKQR 222 + WLAELGPMFFSVK++ + KKQ+ Sbjct: 1139 EPHWLAELGPMFFSVKDSDTSMLEHKKKQK 1168 >At3g26560.1 68416.m03315 ATP-dependent RNA helicase, putative similar to SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain, PF00575: S1 RNA binding domain Length = 1168 Score = 70.1 bits (164), Expect = 8e-13 Identities = 33/77 (42%), Positives = 44/77 (57%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAV 312 +F AR Y P ++HP+SALF PD+V+YH+L MT +EYM VT + Sbjct: 1061 FFFHGARKDPQEGYRTLVENQPVYIHPSSALFQR--QPDWVIYHDLVMTTKEYMREVTVI 1118 Query: 311 DARWLAELGPMFFSVKE 261 D +WL EL P FF V + Sbjct: 1119 DPKWLVELAPRFFKVSD 1135 >At1g32490.1 68414.m04009 RNA helicase, putative similar to ATP-dependent RNA helicase #3 [Homo sapiens] GI:3107913; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1044 Score = 63.3 bits (147), Expect = 9e-11 Identities = 30/88 (34%), Positives = 47/88 (53%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAV 312 +F A+L+ G Y + H+HP S L + P +VVYHEL +T++EYM VT + Sbjct: 952 FFPHTAKLQKNGSYRTVKHPQTVHIHPNSGLSQV--LPRWVVYHELVLTSKEYMRQVTEL 1009 Query: 311 DARWLAELGPMFFSVKETGNRIETSVKK 228 WL EL P ++ +K+ + + K Sbjct: 1010 KPEWLIELAPHYYQLKDVEDAASKKMPK 1037 >At4g16680.1 68417.m02519 RNA helicase, putative similar to SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 883 Score = 62.1 bits (144), Expect = 2e-10 Identities = 27/77 (35%), Positives = 44/77 (57%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAV 312 +F +A+L+ G Y + ++HP S LFG S ++VYHEL +T +EYM T + Sbjct: 768 FFPHSAKLQKNGSYRRVKEPQTVYVHPNSGLFGASPSK-WLVYHELVLTTKEYMRHTTEM 826 Query: 311 DARWLAELGPMFFSVKE 261 WL E+ P ++ +K+ Sbjct: 827 KPEWLIEIAPHYYKLKD 843 >At2g35340.1 68415.m04333 RNA helicase, putative similar to ATP-dependent RNA helicase #3 [Homo sapiens] GI:3107913; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1110 Score = 62.1 bits (144), Expect = 2e-10 Identities = 31/95 (32%), Positives = 52/95 (54%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAV 312 +F A+L+ G Y + H+HP S L + P +VVYH+L +T++EYM VT + Sbjct: 1018 FFPHTAKLQKNGSYRTVKHPQTVHIHPASGLSQV--LPRWVVYHQLVLTSKEYMRQVTEL 1075 Query: 311 DARWLAELGPMFFSVKETGNRIETSVKKQRSTSNA 207 WL E+ P ++ +K+ + TS K +++ A Sbjct: 1076 KPEWLIEIAPHYYQLKDVED--ATSKKMPKTSGRA 1108 >At1g26370.1 68414.m03217 RNA helicase, putative similar to SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 717 Score = 59.3 bits (137), Expect = 1e-09 Identities = 28/77 (36%), Positives = 46/77 (59%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAV 312 +F +AA+ + G Y +G H+HPTS LF P+ V+++EL T+++Y+ +T + Sbjct: 643 FFLKAAQRQLDGTYRALESGEVVHIHPTSVLF--RAKPECVIFNELMQTSKKYIKNLTII 700 Query: 311 DARWLAELGPMFFSVKE 261 D+ WL+EL P F E Sbjct: 701 DSLWLSELAPHHFQTAE 717 >At3g62310.1 68416.m07000 RNA helicase, putative similar to SP|P53131 Pre-mRNA splicing factor RNA helicase PRP43 (Helicase JA1) {Saccharomyces cerevisiae}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 726 Score = 55.2 bits (127), Expect = 2e-08 Identities = 23/80 (28%), Positives = 42/80 (52%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAV 312 YF Q A L+ G Y+ + HLHP++ L P++V+Y+E +T+R ++ VT + Sbjct: 624 YFMQVAHLERTGHYLTVKDNQVVHLHPSNCL---DHKPEWVIYNEYVLTSRNFIRTVTDI 680 Query: 311 DARWLAELGPMFFSVKETGN 252 WL ++ ++ + N Sbjct: 681 RGEWLVDVASHYYDLSNFPN 700 >At2g47250.1 68415.m05900 RNA helicase, putative similar to SP|P53131 Pre-mRNA splicing factor RNA helicase PRP43 (Helicase JA1) {Saccharomyces cerevisiae}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 729 Score = 54.8 bits (126), Expect = 3e-08 Identities = 23/80 (28%), Positives = 41/80 (51%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAV 312 YF Q A L+ G Y+ + HLHP++ L P++V+Y+E +T R ++ VT + Sbjct: 628 YFMQVAHLERTGHYLTVKDNQVVHLHPSNCL---DHKPEWVIYNEYVLTTRNFIRTVTDI 684 Query: 311 DARWLAELGPMFFSVKETGN 252 WL ++ ++ + N Sbjct: 685 RGEWLVDVAQHYYDLSNFPN 704 >At5g14900.1 68418.m01748 helicase associated (HA2) domain-containing protein similar to SP|P53131 Pre-mRNA splicing factor RNA helicase PRP43 (Helicase JA1) {Saccharomyces cerevisiae}; contains Pfam profile PF04408: Helicase associated domain (HA2) Length = 301 Score = 52.4 bits (120), Expect = 2e-07 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 2/77 (2%) Frame = -3 Query: 491 YFQQAARLKGIGEYVNCRT--GMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVT 318 YF Q A L+ G Y+ R HLHP++ L P++VVY+E T+R ++ VT Sbjct: 195 YFMQVAHLERTGHYLTFRDKDDQVVHLHPSNCL---DHKPEWVVYNEYVFTSRNFIRTVT 251 Query: 317 AVDARWLAELGPMFFSV 267 + WL ++ P ++ + Sbjct: 252 HIRGEWLVDVAPHYYKL 268 >At4g18465.1 68417.m02740 RNA helicase, putative similar to SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 704 Score = 52.4 bits (120), Expect = 2e-07 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 2/79 (2%) Frame = -3 Query: 491 YFQQAARLK--GIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVT 318 +F A RL+ G Y R ++HP+S LF + +P +VVY + T R+YM V Sbjct: 623 FFANACRLEPHSNGVYKTIRGSEEVYIHPSSVLFRV--NPKWVVYQSIVSTERQYMRNVV 680 Query: 317 AVDARWLAELGPMFFSVKE 261 ++ WL E+ P F+ ++ Sbjct: 681 TINPSWLTEVAPHFYQNRQ 699 >At1g27900.1 68414.m03419 RNA helicase, putative similar to SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 700 Score = 44.8 bits (101), Expect = 3e-05 Identities = 22/46 (47%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -3 Query: 419 LHPTSALFGL--GCSPDYVVYHELTMTAREYMHCVTAVDARWLAEL 288 +HP+S L G P+YVVYHEL T R +M V AVD W+A + Sbjct: 594 VHPSSVLSADNDGMMPNYVVYHELISTTRPFMRNVCAVDMAWVAPI 639 >At1g33390.1 68414.m04133 helicase domain-containing protein similar to kurz protein [Drosophila melanogaster] GI:5869803; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1237 Score = 44.0 bits (99), Expect = 6e-05 Identities = 24/64 (37%), Positives = 32/64 (50%) Frame = -3 Query: 482 QAARLKGIGEYVNCRTGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAVDAR 303 + AR EY C P LH S+L + +P+ +VY EL +T R YMH T V Sbjct: 1019 RVARKTRATEYQACAVQEPVFLHRWSSL--INSAPELLVYSELLLTNRPYMHGATRVRPE 1076 Query: 302 WLAE 291 WL + Sbjct: 1077 WLVK 1080 >At5g10370.1 68418.m01203 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related similar to RNA-dependent ATPase/helicase Cdc28p [Schizosaccharomyces pombe] GI:1439562; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain, weak hit to PF00097: Zinc finger, C3HC4 type (RING finger), PF01485: IBR domain Length = 1775 Score = 43.6 bits (98), Expect = 8e-05 Identities = 21/52 (40%), Positives = 27/52 (51%) Frame = -3 Query: 437 TGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAVDARWLAELGP 282 TG LHP+ +L G P +VV+ EL +Y+ CVTA D L L P Sbjct: 888 TGQQVQLHPSCSLLAFGQKPSWVVFGELLSIVDQYLVCVTACDFEALYMLDP 939 >At4g01020.1 68417.m00137 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related similar to SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger), PF01485: IBR domain Length = 1787 Score = 41.1 bits (92), Expect = 4e-04 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = -3 Query: 437 TGMPCHLHPTSALFGLGCSPDYVVYHELTMTAREYMHCVTAVDARWLAELGP 282 T LHP+ +L G P +VV+ EL +Y+ CVTA D L L P Sbjct: 885 TSQQVQLHPSCSLLAFGQKPSWVVFGELLSIVDQYLVCVTAFDFEALYMLDP 936 >At1g78700.1 68414.m09173 brassinosteroid signalling positive regulator-related contains similarity to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 325 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 362 GTPRSRGCS-PARTAPRWGAGGTACRCGSSRTRRCPSAAPPAGSKVF 499 GT +GCS P G TA C S + C S P GS F Sbjct: 67 GTTYRKGCSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPGSSNF 113 >At5g47210.1 68418.m05821 nuclear RNA-binding protein, putative similar to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 357 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 368 PRSRGCSPARTAPRWGAGGTACRCGSSRTR 457 P S+ +R AP+ G GGT R G SR R Sbjct: 49 PPSQAVRESRNAPQGGRGGTGGRGGFSRGR 78 >At5g18410.2 68418.m02167 expressed protein similar to p53 inducible protein [Homo sapiens] GI:5616320 Length = 1017 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 456 RVRELPHRHAVPPAPHLGAVRA 391 R+ LP H +PP H+GA+RA Sbjct: 342 RLLTLPAPHELPPLNHIGALRA 363 >At5g18410.1 68418.m02166 expressed protein similar to p53 inducible protein [Homo sapiens] GI:5616320 Length = 1234 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 456 RVRELPHRHAVPPAPHLGAVRA 391 R+ LP H +PP H+GA+RA Sbjct: 342 RLLTLPAPHELPPLNHIGALRA 363 >At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (ABI3) identical to abscisic acid-insensitive protein 3 GI:16146 SP:Q01593 from [Arabidopsis thaliana], (Plant Cell 4 (10), 1251-1261 (1992)) Length = 720 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 312 HGGDAVHVLARRHGELVVHH 371 HGGD HV + +L+VHH Sbjct: 45 HGGDNNHVHGHQDDDLIVHH 64 >At2g33360.1 68415.m04089 expressed protein Length = 603 Score = 26.6 bits (56), Expect = 9.4 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 362 GTPRSRGCSPARTAPRWGAGGTACRCGSSRTRRCP 466 G PR+R P+ RW +GG C C S CP Sbjct: 488 GGPRNRNGGPSSLIQRWKSGG-CCDC-SGWDLGCP 520 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,190,337 Number of Sequences: 28952 Number of extensions: 139308 Number of successful extensions: 481 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -