BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30263 (604 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 1.1 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 1.1 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 23 2.0 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 22 3.5 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 8.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.0 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.8 bits (49), Expect = 1.1 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +2 Query: 167 KTVRSCLLYHSQCSSIVRGERLFALGDYRYAKEAFFCHQEEEGNLQ 304 K V C L S + + G R ALG AK +E + ++Q Sbjct: 496 KVVAECTLKESAAINQILGRRWHALGREEQAKYYELARRERQLHMQ 541 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.8 bits (49), Expect = 1.1 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +2 Query: 167 KTVRSCLLYHSQCSSIVRGERLFALGDYRYAKEAFFCHQEEEGNLQ 304 K V C L S + + G R ALG AK +E + ++Q Sbjct: 388 KVVAECTLKESAAINQILGRRWHALGREEQAKYYELARRERQLHMQ 433 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 23.0 bits (47), Expect = 2.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 212 IVRGERLFALGDYRYAKEAFFCHQEEE 292 +V+ ERL +LG A E +C Q EE Sbjct: 562 LVQRERLISLGINSDALEPEWCWQNEE 588 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 434 PWYQPSFTEVRKVLQLFRLRQINNG 508 P QP+ R + R++Q+NNG Sbjct: 80 PQQQPASVARRNARERNRVKQVNNG 104 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.0 bits (42), Expect = 8.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 245 LLVRRASLLLRCLSTDCGTAG 183 LLV SL+ CL T+C G Sbjct: 10 LLVLSESLVSGCLITNCPRGG 30 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +2 Query: 176 RSCLLYHSQCSSIVRGERLFALG 244 R C L+H + R +F LG Sbjct: 577 RICTLHHHLSKLVTRFNEIFGLG 599 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,149 Number of Sequences: 336 Number of extensions: 2379 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -