BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30263 (604 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H5.07 |rpl702|rpl7-2, rpl7, rpl7b|60S ribosomal protein L7|... 86 3e-18 SPBC18H10.12c |rpl701||60S ribosomal protein L7|Schizosaccharomy... 84 1e-17 SPAC664.06 |rpl703|rpl7|60S ribosomal protein L7|Schizosaccharom... 74 1e-14 SPBC18H10.07 |||WW domain-binding protein 4 |Schizosaccharomyces... 29 0.52 SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 26 3.7 >SPAC3H5.07 |rpl702|rpl7-2, rpl7, rpl7b|60S ribosomal protein L7|Schizosaccharomyces pombe|chr 1|||Manual Length = 250 Score = 86.2 bits (204), Expect = 3e-18 Identities = 43/82 (52%), Positives = 54/82 (65%), Gaps = 1/82 (1%) Frame = +3 Query: 243 EITGTLKRRSSAIKKKREIF-KRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKLA 419 +I + SA +KKRE+ KRAE Y EYR ER++I LAR+AR GNY+VP E KL Sbjct: 32 QIVAAAAEKKSARQKKRELIAKRAEAYEAEYRAAEREQIELARKARAEGNYFVPHEPKLI 91 Query: 420 FVIRIRGINQVSPKSVKFCNCL 485 FV+RIRGIN + PK+ K L Sbjct: 92 FVVRIRGINNIPPKARKIMQLL 113 Score = 42.3 bits (95), Expect = 5e-05 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 508 LFVRLNKATVNMLRIAEPYIAWG*PNLKSVRE 603 +FV+ NKA ML++ EPY+ +G PN K+VRE Sbjct: 122 IFVKFNKAIKEMLQVVEPYVTYGIPNHKTVRE 153 Score = 27.9 bits (59), Expect = 1.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 458 EVRKVLQLFRLRQINNG 508 + RK++QL RL QINNG Sbjct: 105 KARKIMQLLRLLQINNG 121 >SPBC18H10.12c |rpl701||60S ribosomal protein L7|Schizosaccharomyces pombe|chr 2|||Manual Length = 251 Score = 84.2 bits (199), Expect = 1e-17 Identities = 42/74 (56%), Positives = 51/74 (68%), Gaps = 1/74 (1%) Frame = +3 Query: 267 RSSAIKKKREIF-KRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKLAFVIRIRGI 443 + +A +KKRE+ KRAE Y EYR ER++I L R+AR GNYYVP E KL FVIRIRGI Sbjct: 41 KKAAQQKKRELIAKRAESYDAEYRKAEREQIELGRKARAEGNYYVPDETKLVFVIRIRGI 100 Query: 444 NQVSPKSVKFCNCL 485 N + PK+ K L Sbjct: 101 NNIPPKARKIMQLL 114 Score = 47.2 bits (107), Expect = 2e-06 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +1 Query: 508 LFVRLNKATVNMLRIAEPYIAWG*PNLKSVRE 603 +FV+ NKAT ML++ EPY+ +G PNLK+VRE Sbjct: 123 VFVKFNKATKEMLQVVEPYVTYGIPNLKTVRE 154 Score = 27.5 bits (58), Expect = 1.6 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 458 EVRKVLQLFRLRQINNG 508 + RK++QL RL QINNG Sbjct: 106 KARKIMQLLRLIQINNG 122 >SPAC664.06 |rpl703|rpl7|60S ribosomal protein L7|Schizosaccharomyces pombe|chr 1|||Manual Length = 249 Score = 74.1 bits (174), Expect = 1e-14 Identities = 33/76 (43%), Positives = 49/76 (64%) Frame = +3 Query: 258 LKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKLAFVIRIR 437 + ++ + K ++E FKRAE ++ YR +ER+ IRL R A+N+G+ +VP E KL FVIRI Sbjct: 37 IAKKEAQKKNRKETFKRAETFINNYRQRERERIRLNRSAKNKGDIFVPDETKLLFVIRIA 96 Query: 438 GINQVSPKSVKFCNCL 485 G+ + PK K L Sbjct: 97 GVKNMPPKIRKVLRLL 112 Score = 46.4 bits (105), Expect = 3e-06 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +1 Query: 508 LFVRLNKATVNMLRIAEPYIAWG*PNLKSVRE 603 +FVR NKA MLRI EPY+ +G PNL SVRE Sbjct: 121 VFVRNNKAVAQMLRIVEPYVMYGIPNLHSVRE 152 Score = 25.0 bits (52), Expect = 8.5 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +2 Query: 458 EVRKVLQLFRLRQINN 505 ++RKVL+L RL +INN Sbjct: 104 KIRKVLRLLRLSRINN 119 >SPBC18H10.07 |||WW domain-binding protein 4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 224 Score = 29.1 bits (62), Expect = 0.52 Identities = 11/39 (28%), Positives = 25/39 (64%) Frame = +3 Query: 273 SAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGN 389 +++K+ REI ++ E+ +R+K ++ ++ + A N GN Sbjct: 151 TSLKRNREIIEKEERSSFHFRVKPKNLDKVPKLAENEGN 189 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 26.2 bits (55), Expect = 3.7 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +3 Query: 306 RAEQYVKEYRIKERDEIRLARQARNRGNYYVPGE 407 +A Q ++ + +RL N+ N+++PGE Sbjct: 309 KATQMTVDFLVDWAKSVRLCANRFNKSNFFIPGE 342 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,211,051 Number of Sequences: 5004 Number of extensions: 39428 Number of successful extensions: 110 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 264253462 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -