BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30263 (604 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 93 1e-19 SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_51900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_12133| Best HMM Match : DUF827 (HMM E-Value=0.64) 28 5.1 SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) 28 6.7 SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) 27 8.8 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 93.5 bits (222), Expect = 1e-19 Identities = 44/67 (65%), Positives = 53/67 (79%) Frame = +3 Query: 285 KKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKLAFVIRIRGINQVSPKS 464 K++EIFKRAE+YVKEYR KE DE+R+ + A+ GN+YVP EA+LAFVIRIRGIN VSPK Sbjct: 43 KRKEIFKRAEKYVKEYRQKEVDELRMKKMAKKHGNFYVPPEARLAFVIRIRGINGVSPKV 102 Query: 465 VKFCNCL 485 K L Sbjct: 103 RKILQLL 109 Score = 56.8 bits (131), Expect = 1e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 508 LFVRLNKATVNMLRIAEPYIAWG*PNLKSVRE 603 +FVRLNKAT NMLRI +PYIA+G PNLKSVRE Sbjct: 118 VFVRLNKATANMLRIVQPYIAFGYPNLKSVRE 149 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = +2 Query: 458 EVRKVLQLFRLRQINNG 508 +VRK+LQL RLRQINNG Sbjct: 101 KVRKILQLLRLRQINNG 117 >SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1211 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 364 PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSATV*TAPNK 501 PDK A+ TTT P + ++ T + R P S T+ T P K Sbjct: 363 PDKTAVPKTTTAPETTDASKTTVETQQTTYSRDPEISVTISTQPKK 408 >SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 267 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 392 R AI ++RE+++R E Y + + R+ R R R Y Sbjct: 16 RRRAINRRREMYRRREMYRRREMYRRREMYRRREMYRRREMY 57 >SB_51900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = +3 Query: 249 TGTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGE-AKLAFV 425 TG L+ R +K R+ + EY++ + I R+ARN N + + A++ + Sbjct: 21 TGLLELRGKKLKITRDSWLNYALNYTEYQLLRPNNILYRRKARNNLNSQITRDYAEICGL 80 Query: 426 IRIRGINQVS 455 +RG +Q++ Sbjct: 81 CGLRGKSQIT 90 >SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 267 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 392 R + ++REI++R E Y + + R+ RL R R Y Sbjct: 27 RRREMYRRREIYRRREMYRRREMYRRREMYRLREMYRRREMY 68 >SB_12133| Best HMM Match : DUF827 (HMM E-Value=0.64) Length = 325 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +3 Query: 219 EERGSSH*EITGTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRG 386 EE+ + ++ L+ R I+K AE+ +K R+KE D I + +RG Sbjct: 210 EEKDAELQQLRQALRERDRLIEKINSAVMSAEEQLKVRRLKEDDSIDQLSRHEHRG 265 >SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) Length = 712 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 339 KERDEIRLARQARNRGNYYVP 401 K RD +AR+ R+RG YY+P Sbjct: 483 KIRDTSSIARETRSRGPYYLP 503 >SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) Length = 458 Score = 27.5 bits (58), Expect = 8.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +1 Query: 298 SSRGLNSTSRNTASRNVMKSD*PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSA 477 ++ G + TSR+T S K A T + +P+W L+S + VS R+P S+ Sbjct: 165 TTNGPSKTSRSTDGEESAGSTHTKKPAKDDTDSSADEPDWDLTS-AFVSRAAGRNPTSTT 223 Query: 478 TV 483 TV Sbjct: 224 TV 225 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,951,696 Number of Sequences: 59808 Number of extensions: 316566 Number of successful extensions: 845 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -