BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30263 (604 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003139-2|AAB54165.1| 244|Caenorhabditis elegans Ribosomal pro... 80 1e-15 U41106-1|AAA82409.1| 347|Caenorhabditis elegans Hypothetical pr... 31 0.48 AF067940-8|AAC19200.1| 518|Caenorhabditis elegans Hypothetical ... 29 3.4 AF016430-4|AAB65372.1| 594|Caenorhabditis elegans Hypothetical ... 28 5.9 >AF003139-2|AAB54165.1| 244|Caenorhabditis elegans Ribosomal protein, large subunitprotein 7 protein. Length = 244 Score = 80.2 bits (189), Expect = 1e-15 Identities = 35/63 (55%), Positives = 50/63 (79%) Frame = +3 Query: 282 KKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKLAFVIRIRGINQVSPK 461 +KK + FKRAE+YV+EYR +++ +RL R+A +G++YVP E K+AFV+RIRGINQ+ PK Sbjct: 41 EKKTQYFKRAEKYVQEYRNAQKEGLRLKREAEAKGDFYVPAEHKVAFVVRIRGINQLHPK 100 Query: 462 SVK 470 K Sbjct: 101 PRK 103 Score = 48.4 bits (110), Expect = 4e-06 Identities = 19/32 (59%), Positives = 27/32 (84%) Frame = +1 Query: 508 LFVRLNKATVNMLRIAEPYIAWG*PNLKSVRE 603 +FV+LNKAT+ +LRI EPY+AWG PN K++ + Sbjct: 117 VFVKLNKATLPLLRIIEPYVAWGYPNNKTIHD 148 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +2 Query: 464 RKVLQLFRLRQINNG 508 RK LQ+ RLRQINNG Sbjct: 102 RKALQILRLRQINNG 116 >U41106-1|AAA82409.1| 347|Caenorhabditis elegans Hypothetical protein W06A11.4 protein. Length = 347 Score = 31.5 bits (68), Expect = 0.48 Identities = 21/71 (29%), Positives = 32/71 (45%) Frame = +1 Query: 283 RRRGKSSRGLNSTSRNTASRNVMKSD*PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRS 462 ++R K SR SR ASR +K K A +T P +PN + S S S ++ + Sbjct: 21 KKRRKMSRKFTKKSRKRASRASIKLANEQKAKKYANSTVPMEPNVYTDSGSPFSNRYASN 80 Query: 463 P*SSATV*TAP 495 S + + P Sbjct: 81 RSSQVKIRSVP 91 >AF067940-8|AAC19200.1| 518|Caenorhabditis elegans Hypothetical protein F36F12.1 protein. Length = 518 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 383 WQLLRSRGSQIGICHPNPWYQPSFTEV-RKVLQLFRLRQINN 505 +Q++R G Q+GI PW P F++V R L+ R ++ N Sbjct: 210 YQMVRELG-QLGIVTTQPWLTPKFSQVARPFLEPSRNSELRN 250 >AF016430-4|AAB65372.1| 594|Caenorhabditis elegans Hypothetical protein C05C8.5 protein. Length = 594 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 480 CLDCAK*TMVVCTSE*GYCEY-ATYRRALHCLGI 578 C DC++ T+V CT C + +T + +HC+ I Sbjct: 415 CTDCSQPTVVACTVANCRCRFVSTPSKCVHCVKI 448 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,381,316 Number of Sequences: 27780 Number of extensions: 225315 Number of successful extensions: 609 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1289949676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -