BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30261 (586 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 25 0.62 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 5.8 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 7.7 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 24.6 bits (51), Expect = 0.62 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +2 Query: 308 QRYKSLTKSFGR--TIIQDFFRKEKII*RRIYLRDNKICQLTK 430 Q K L SF ++ + FFR ++ ++YL NK+ TK Sbjct: 223 QNIKVLDLSFNNITSVAKQFFRPVELSLMQLYLGHNKLLNATK 265 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 415 LSADEMSVFYKAFL 456 LSA ++ VF+K FL Sbjct: 161 LSASDLGVFFKRFL 174 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 505 SCTIQCCTRCELSNFYLKTLCRI 437 +C IQ T+CE+ + L+ L +I Sbjct: 191 TCLIQIETQCEIVSDTLRNLDKI 213 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,433 Number of Sequences: 336 Number of extensions: 2624 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -