BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30261 (586 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0166 - 6065088-6065093,6066671-6068544,6068643-6069548,606... 30 1.6 10_02_0129 + 5584585-5584732,5586567-5586968,5587038-5587106,558... 30 1.6 06_03_0032 - 15697530-15697669,15699215-15699437,15699823-156999... 29 2.7 09_01_0005 - 193214-193228,193659-193776,193876-194072,194534-19... 28 6.3 08_01_0206 - 1645033-1645133,1645739-1645800,1645935-1646128 28 6.3 05_04_0141 - 18364065-18364176,18364722-18364948,18365183-183653... 28 6.3 10_08_0568 + 18837195-18837203,18837694-18837741,18837853-188379... 27 8.3 04_04_1650 - 35051728-35051823,35052054-35052162,35052270-350524... 27 8.3 03_02_0919 - 12392471-12392636,12392740-12392931,12393366-123934... 27 8.3 03_01_0338 - 2667578-2668659,2668771-2668828 27 8.3 >10_02_0166 - 6065088-6065093,6066671-6068544,6068643-6069548, 6069623-6069676,6069751-6069808 Length = 965 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +1 Query: 229 SIEFTKGNFKQPTNETKMEKTYREMRTEVQEFNQKFWTHHNTRFFQERED 378 +I F G+F T +++ Y MR+ V F +HN F +R++ Sbjct: 130 NIRFFNGHFSFTTLGVSLDERYTNMRSGVYTFRAHGQIYHNIHSFGQRDN 179 >10_02_0129 + 5584585-5584732,5586567-5586968,5587038-5587106, 5587181-5587234,5587309-5588214,5588313-5590283, 5590833-5591235,5591845-5591857 Length = 1321 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +1 Query: 229 SIEFTKGNFKQPTNETKMEKTYREMRTEVQEFNQKFWTHHNTRFFQERED 378 +I F G+F T +++ Y MR+ V F +HN F +R++ Sbjct: 317 NIRFFNGHFSFTTLGVSLDERYTNMRSGVYTFRAHGQIYHNIHSFGQRDN 366 >06_03_0032 - 15697530-15697669,15699215-15699437,15699823-15699929, 15700047-15700224,15700393-15700455,15700474-15700602, 15701211-15701430,15702162-15702262,15702954-15703062, 15705169-15705290,15705473-15705515,15705848-15705903, 15705983-15706089,15706167-15706342,15706507-15706618, 15706711-15706759,15707184-15707276,15707452-15707571, 15707686-15707787,15709442-15709540,15710103-15710237, 15710421-15710499,15710747-15710822,15710904-15710993, 15711139-15711217,15711304-15711338,15711457-15711531, 15712628-15713375 Length = 1221 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +1 Query: 244 KGNFKQPTNETK-MEKT--YREMRTEVQEFNQKFWTHH 348 + NF +PT++ + EKT + + T ++E ++W HH Sbjct: 597 EANFIRPTHDKQDFEKTGLFHRLETRLKEMTLEYWKHH 634 >09_01_0005 - 193214-193228,193659-193776,193876-194072,194534-195493 Length = 429 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/58 (24%), Positives = 30/58 (51%) Frame = +1 Query: 295 REMRTEVQEFNQKFWTHHNTRFFQEREDYLKKNLPEGQQNLSADEMSVFYKAFLDKNW 468 +++R +V+ F +++ T F + E K P G Q + + + F KA++++ W Sbjct: 319 KQVRRKVKGFFKRY-PDAQTAFSADPEKMAKYLAPLGLQRVKVNRIQRFSKAYVEEEW 375 >08_01_0206 - 1645033-1645133,1645739-1645800,1645935-1646128 Length = 118 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 520 NNLKSSCTIQCCTRCELSNFYLKTLCRIHSFRQ 422 N +S C QCC C + + C IH FR+ Sbjct: 60 NVARSRCPFQCCKSC---CYKAQNPCHIHGFRE 89 >05_04_0141 - 18364065-18364176,18364722-18364948,18365183-18365390, 18365497-18365706,18366078-18366180,18366214-18366325, 18367061-18367204,18367835-18367936,18368081-18368186, 18368301-18368335 Length = 452 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = +2 Query: 107 IKRHKVWSYLLLRQLNTNDSKCVQIPNPKKISSDMVGPPDPVSNLRRVILNSLQTKRKWR 286 IK + V Y +L ++ N PN I +M+ PP+ VS + V+ ++ + WR Sbjct: 120 IKDNFVLVYQILDEMMDNGFPLTTEPN---ILKEMIAPPNIVSKMLNVVTDAAASFVPWR 176 Query: 287 KLI 295 + Sbjct: 177 TTV 179 >10_08_0568 + 18837195-18837203,18837694-18837741,18837853-18837912, 18837986-18838155,18838297-18838369,18838529-18838594, 18838685-18838768,18838950-18839027,18839122-18839205, 18839562-18839641,18839791-18839848,18839933-18840235, 18840361-18840531,18840972-18841204,18841303-18841705, 18841961-18842212,18842293-18842790,18843073-18843170, 18843314-18843413,18843653-18843798,18843912-18844068 Length = 1056 Score = 27.5 bits (58), Expect = 8.3 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +1 Query: 373 EDYLKKNLPEGQQNLSADEMSVFYK-AFLDKNW 468 ED++ + P GQ+ L A +M+ Y A ++K+W Sbjct: 65 EDFVDPDTPAGQKKLLASQMAKQYNPAAVEKSW 97 >04_04_1650 - 35051728-35051823,35052054-35052162,35052270-35052416, 35052516-35052637,35052726-35052825,35052895-35053095, 35053202-35053407,35053778-35053803,35054239-35054327, 35054427-35054635,35055577-35055672,35055754-35055924 Length = 523 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 217 SAGSSIEFTKGNFKQPTNETKMEKTYREMRTEVQEFNQKF 336 S GSSI+ T+G+F+ N T +E ++ FN +F Sbjct: 379 SVGSSIDVTQGSFRNIKNSTTSRSVIKE---RLKCFNMRF 415 >03_02_0919 - 12392471-12392636,12392740-12392931,12393366-12393463, 12393719-12394219,12394287-12394532,12395627-12396029, 12396155-12396348,12396755-12396925,12397064-12397366, 12397463-12397520,12397678-12397757,12398910-12398987, 12399530-12399613,12399692-12399757,12399908-12399980, 12400080-12400249,12400368-12400427,12400632-12400679, 12401217-12401255,12401364-12401372 Length = 1012 Score = 27.5 bits (58), Expect = 8.3 Identities = 12/35 (34%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 373 EDYLKKNLPEGQQNLSADEMSVFY-KAFLDKNWKA 474 ED++ ++ P GQ+ L A +M+ Y + ++K+W A Sbjct: 78 EDFIDQDTPNGQKKLLAPQMANQYCPSTVEKSWYA 112 >03_01_0338 - 2667578-2668659,2668771-2668828 Length = 379 Score = 27.5 bits (58), Expect = 8.3 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -2 Query: 315 YLCSHLSISFLHFRFVCRLFKITLRKF--DTGSGG 217 +LCSHL H R R K TLRK D G G Sbjct: 132 FLCSHLLKDIEHIRLRYRPLKHTLRKLASDVGVSG 166 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,291,824 Number of Sequences: 37544 Number of extensions: 234269 Number of successful extensions: 625 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -