BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30261 (586 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49337| Best HMM Match : SGS (HMM E-Value=3.3) 50 1e-06 SB_30481| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) 31 0.91 SB_25293| Best HMM Match : DUF1665 (HMM E-Value=0.098) 30 1.6 SB_899| Best HMM Match : Alpha_L_fucos (HMM E-Value=0) 29 2.8 SB_21167| Best HMM Match : KH_1 (HMM E-Value=0) 29 3.7 SB_18710| Best HMM Match : Glycophorin_A (HMM E-Value=0.42) 29 3.7 SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_22827| Best HMM Match : TM_helix (HMM E-Value=0.57) 28 4.9 SB_42261| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_4668| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_56761| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_49310| Best HMM Match : Piwi (HMM E-Value=4.9e-33) 28 6.4 SB_40742| Best HMM Match : Pox_A32 (HMM E-Value=0.042) 28 6.4 SB_38290| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_25069| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_23568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_15879| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_15033| Best HMM Match : Dynein_light (HMM E-Value=4) 27 8.5 SB_1752| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_25978| Best HMM Match : PqqD (HMM E-Value=1.7) 27 8.5 SB_7884| Best HMM Match : rve (HMM E-Value=2.1e-15) 27 8.5 SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) 27 8.5 >SB_49337| Best HMM Match : SGS (HMM E-Value=3.3) Length = 230 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +1 Query: 388 KNLPEGQQNLSADEMSVFYKAFLDKNWKAHISYNIEWYKK 507 ++L G+Q +ADE+SVFYK FLDKN++ H Y EWYKK Sbjct: 78 ESLKGGKQ--AADELSVFYKDFLDKNYQLHKEYQWEWYKK 115 >SB_30481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 31.1 bits (67), Expect = 0.69 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 1/83 (1%) Frame = +1 Query: 274 TKMEKTYREMRTEVQ-EFNQKFWTHHNTRFFQEREDYLKKNLPEGQQNLSADEMSVFYKA 450 T+ Y E T+ E+N ++ T +NT + E +Y+ + + E + + E + Y Sbjct: 101 TEYNNEYTEYNTDYNTEYNTEYNTEYNTEYNTEYTEYITEYITEYNTDYNT-EYNTEYNT 159 Query: 451 FLDKNWKAHISYNIEWYKKILSY 519 + N + + YN E+ + I Y Sbjct: 160 --EYNTEYNTEYNTEYTEYITEY 180 >SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) Length = 2086 Score = 30.7 bits (66), Expect = 0.91 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Frame = +2 Query: 188 PKKISSDMVGPPDPVSNLRRVILNSLQTKRKWRK----LIER*EQRYKSLTKSFGRTII- 352 P +++ D+ P +NLRR+ NS+Q+ ++W K L E L K F II Sbjct: 630 PSELTLDVTCTPRNRANLRRLKTNSVQSFQRWEKENELLYAMIEDETAWLAKLFTEIIIT 689 Query: 353 QDFF 364 DFF Sbjct: 690 PDFF 693 >SB_25293| Best HMM Match : DUF1665 (HMM E-Value=0.098) Length = 1450 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 230 VSNLRRVILNSLQTKRKWRKLIER*EQRYKSLTKS-FGRTIIQDFFRKEK 376 V N R+++L + + R W + + QR++S+ K + R +++ F K K Sbjct: 489 VLNRRKIVLKAFYSWRNWTEYAKVLHQRFQSMCKEYYNRALVRQTFVKWK 538 >SB_899| Best HMM Match : Alpha_L_fucos (HMM E-Value=0) Length = 1127 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +1 Query: 334 FWTHHNTRFFQEREDYLKKNLPEGQQNLSADEMSVFYKAFLDKNWKAHI 480 FW H + + +++KKN P G AD +F F D N+ A + Sbjct: 63 FWNHWKQQHYPSCIEFMKKNYPSGFS--YADFGPMFKAEFFDPNYFAKL 109 >SB_21167| Best HMM Match : KH_1 (HMM E-Value=0) Length = 1650 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +2 Query: 209 MVGPPDPVSNLRRVILNSLQTKRKWRKLIER*EQRYKSLTKSFGRTI 349 + G PD V+ RR++L+ LQT+ + I R + +K + G+T+ Sbjct: 173 VTGKPDTVAKARRLVLSQLQTQAQIEIQIPR--EHHKFILGKGGKTL 217 >SB_18710| Best HMM Match : Glycophorin_A (HMM E-Value=0.42) Length = 1451 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 208 YGRSAGSSIEFTKGNFKQPTNETKMEKTYREMRTEVQEF 324 Y G + EF++ T + + TY E+RTEV+++ Sbjct: 1320 YEELRGDNSEFSEQKRDSSTRKDQASDTYEELRTEVKDY 1358 >SB_9343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 786 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/51 (29%), Positives = 28/51 (54%) Frame = +1 Query: 250 NFKQPTNETKMEKTYREMRTEVQEFNQKFWTHHNTRFFQEREDYLKKNLPE 402 N +QP +T+ T +++ ++ + W HH+ F+E D +K NLP+ Sbjct: 102 NPQQPAPKTR---TTNQLQFLLKTVLKGLWRHHHAWPFREPVDAVKLNLPD 149 >SB_22827| Best HMM Match : TM_helix (HMM E-Value=0.57) Length = 969 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -2 Query: 243 RKFDTGSGGPTISLEIFFG---FGI*THLESFVLS 148 R+F +GSG P++S E F+G F + L + VLS Sbjct: 233 RRFVSGSGAPSVSPESFYGDNKFALWIELRTTVLS 267 >SB_42261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 544 SLTCKPSLNNLKSSCTIQCCTRCELSNFYLKTLCRIHS 431 S TC PS ++ S CT + CT ++ KTL + + Sbjct: 112 SQTCSPSTKSIGSECTTE-CTEADVQATCEKTLVSVET 148 >SB_4668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.9 bits (59), Expect = 6.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 412 NLSADEMSVFYKAFLD-KNWKAHISYNIEWYKK 507 N + E + Y A D NWK ++SY I+WYK+ Sbjct: 72 NKAVMECHLQYMARFDFPNWK-NVSYEIKWYKQ 103 >SB_56761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 633 Score = 27.9 bits (59), Expect = 6.4 Identities = 16/69 (23%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = +1 Query: 298 EMRTEVQ-EFNQKFWTHHNTRFFQEREDYLKKNLPEGQQNLSADEMSVFYKAF-LDKNWK 471 E TE E+N ++ T +NT + E +Y+ + + E + + D + + + + N + Sbjct: 377 EYNTEYNTEYNTEYNTEYNTEYNTEYTEYITEYITEYNTDYNTDYNTEYNTEYNTEYNTE 436 Query: 472 AHISYNIEW 498 + YN E+ Sbjct: 437 YNTEYNTEY 445 >SB_49310| Best HMM Match : Piwi (HMM E-Value=4.9e-33) Length = 952 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 363 KKSCIMVRPKLLVKLLYLCSHLSISFLHF 277 +KS V P+LL+ Y C H+SI ++HF Sbjct: 916 QKSFSDVFPRLLLSFAY-CGHVSIVYVHF 943 >SB_40742| Best HMM Match : Pox_A32 (HMM E-Value=0.042) Length = 579 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = -2 Query: 243 RKFDTGSGGPTISLEIFFG---FGI*THLES 160 R+F +GSG P++S E F+G F + HL + Sbjct: 323 RRFVSGSGAPSVSSESFYGHNKFALWIHLRT 353 >SB_38290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 Query: 182 PNPKKISSDMVGPPDPVSNLRRVILNSLQTKRKWRKL 292 PNP+ D P PV LR L + +KWR + Sbjct: 48 PNPRINGEDNNQDPRPVIRLRHAQLAEIVDDKKWRSI 84 >SB_25069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 Query: 182 PNPKKISSDMVGPPDPVSNLRRVILNSLQTKRKWRKL 292 PNP+ D P PV LR L + +KWR + Sbjct: 74 PNPRINGEDNNQDPRPVIRLRHAQLAEIVDDKKWRSI 110 >SB_23568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 4/75 (5%) Frame = +1 Query: 235 EFTKGNFKQPTNETK-MEKTYREMRTE---VQEFNQKFWTHHNTRFFQEREDYLKKNLPE 402 +F+ GNFK E + + ++++R ++ + F++ HN +F + L +N Sbjct: 100 DFSAGNFKLCLRELQNFDGAHKDIRVNWLAYEDLPRNFFSEHNVLYFANLQSPLAENRHA 159 Query: 403 GQQNLSADEMSVFYK 447 QN+ E +V Y+ Sbjct: 160 FSQNV---EFAVNYR 171 >SB_15879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = -1 Query: 538 TCKPSLNNLKSSCT--IQC--CTRCELSNFYLKTLCRIHS 431 TC S KSS QC C +C SN+ LK RIHS Sbjct: 53 TCSDSQKPKKSSDKKLFQCKECGKCITSNYSLKEHLRIHS 92 >SB_15033| Best HMM Match : Dynein_light (HMM E-Value=4) Length = 434 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 544 SLTCKPSLNNLKSSCTIQC 488 S TC PS+ ++ S CT +C Sbjct: 211 SQTCSPSIKSIGSECTTEC 229 >SB_1752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +2 Query: 71 NSIVMVPIRVKNIKRHKVWSYLLLRQLNTNDSKCVQIPNPKKISSDMV 214 NS+ V + + R + S + LR++ + +S C + PNP +SDM+ Sbjct: 231 NSVSTVSLTLSENSRRGLRS-VFLREVTSPNSICQRNPNPFSTTSDMM 277 >SB_25978| Best HMM Match : PqqD (HMM E-Value=1.7) Length = 303 Score = 27.5 bits (58), Expect = 8.5 Identities = 20/99 (20%), Positives = 41/99 (41%), Gaps = 4/99 (4%) Frame = +1 Query: 184 KSEEDLK*YGRSAGSSIEFTKGNFKQPTNETKMEKTY----REMRTEVQEFNQKFWTHHN 351 K+ E++K R + ++ F + E Y MR +EF +H + Sbjct: 33 KATEEVKSGNRDIANKVQHIGNKFLNAVEISAQEAAYLVLQMPMRRSTREFQFINTSHLD 92 Query: 352 TRFFQEREDYLKKNLPEGQQNLSADEMSVFYKAFLDKNW 468 R F ++ +K LP+ ++ +D + Y+ +N+ Sbjct: 93 ERTFLLKKFDKRKELPDNSPDIESDNLIERYQRRPKRNY 131 >SB_7884| Best HMM Match : rve (HMM E-Value=2.1e-15) Length = 813 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -2 Query: 243 RKFDTGSGGPTISLEIFFG 187 R+F +GSG P++S E F+G Sbjct: 222 RRFVSGSGAPSVSRESFYG 240 >SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) Length = 2024 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +1 Query: 235 EFTKGNFKQPTNETKMEKTYREMRTEVQEFNQKFWTHHNTRFFQEREDYLKK 390 E K NFK T T++ + + E ++ NQ+ ++ R E+ED L++ Sbjct: 324 EAEKANFKLKTEVTELNLKLKSYQQENEDLNQEVISYQ--RKVSEKEDQLQR 373 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,716,283 Number of Sequences: 59808 Number of extensions: 284384 Number of successful extensions: 2604 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2599 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -