BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30261 (586 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 3.9 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 3.9 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 5.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 6.7 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 6.7 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 8.9 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.9 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 21 8.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 8.9 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 406 VPQVNSSSNNLLFPE-KILYY 347 +P VNS+S N FP KI+ Y Sbjct: 72 IPGVNSTSENKTFPTIKIVGY 92 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 406 VPQVNSSSNNLLFPE-KILYY 347 +P VNS+S N FP KI+ Y Sbjct: 72 IPGVNSTSENKTFPTIKIVGY 92 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = -1 Query: 472 LSNFYLKTLCRIHSFRQLTNFVVPQVNSSSNNLLFPEKILY 350 ++ + L +C + + +T+ V S+NNL K++Y Sbjct: 1 MTKWLLLVVCLGIACQDVTSAAVNHQRKSANNLAHSMKVIY 41 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 229 SIEFTKGNFKQPTNETKMEKTYREMRTEVQEFNQ 330 +++F+K + K+ + KTY + VQ FN+ Sbjct: 1029 TVDFSKEDGKEHHLQIMNLKTYTQYSVVVQAFNK 1062 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 318 LYLCSHLSISFLHFR 274 LYL HL++SF FR Sbjct: 260 LYLPFHLTLSFRDFR 274 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 318 LYLCSHLSISFLHFR 274 LYL HL++SF FR Sbjct: 255 LYLPFHLTLSFRDFR 269 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 Query: 113 FLYFLHELAPSRYY 72 F +FLH+ +RYY Sbjct: 257 FYFFLHKQVLNRYY 270 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/35 (22%), Positives = 18/35 (51%) Frame = -1 Query: 451 TLCRIHSFRQLTNFVVPQVNSSSNNLLFPEKILYY 347 TL ++H+F +T + Q + ++FP + + Sbjct: 425 TLAQLHNFTTMTPQEIAQWIDRRSRIVFPVAFIIF 459 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 481 SYNIEWYKKILS 516 +YNI+W K ILS Sbjct: 106 NYNIDWDKCILS 117 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 Query: 113 FLYFLHELAPSRYY 72 F +FLH+ +RYY Sbjct: 257 FYFFLHKQVLNRYY 270 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,398 Number of Sequences: 438 Number of extensions: 3158 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -