BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30261 (586 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60520.1 68418.m07589 late embryogenesis abundant protein-rel... 31 0.57 At2g19120.1 68415.m02232 tRNA-splicing endonuclease positive eff... 30 1.3 At5g01310.1 68418.m00043 basic helix-loop-helix (bHLH) family pr... 29 1.7 At3g49500.1 68416.m05410 RNA-dependent RNA polymerase (SDE1) ide... 29 1.7 At5g43140.1 68418.m05266 peroxisomal membrane 22 kDa family prot... 28 5.3 At3g27260.1 68416.m03407 DNA-binding bromodomain-containing prot... 28 5.3 At5g60530.1 68418.m07590 late embryogenesis abundant protein-rel... 27 7.0 At5g03000.1 68418.m00245 kelch repeat-containing F-box family pr... 27 7.0 At3g22030.1 68416.m02779 receptor-like protein kinase-related co... 27 7.0 At5g47990.1 68418.m05929 cytochrome P450 family protein similar ... 27 9.2 At3g02570.1 68416.m00248 phosphomannose isomerase type I family ... 27 9.2 At1g77980.1 68414.m09087 MADS-box family protein MADS-box protei... 27 9.2 >At5g60520.1 68418.m07589 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 338 Score = 31.1 bits (67), Expect = 0.57 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 532 KPSLNNLKSSCTIQCCTRCELSNFYLKTLC 443 KP +N K +C I C ++CE++ + K C Sbjct: 74 KPKMNKKKKACFIDCSSKCEVTCKWRKANC 103 >At2g19120.1 68415.m02232 tRNA-splicing endonuclease positive effector-related similar to Endonuclease sen1 (Swiss-Prot:Q92355) [Schizosaccharomyces pombe]; similar to tRNA-splicing endonuclease positive effector (Swiss-Prot:Q00416) [Saccharomyces cerevisiae] Length = 1090 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 211 GRSAGSSIEFTKGNFKQP-TNETKMEKTYREMRTEVQEFNQKFWTH 345 G S+ + +++ +FK+P T+ T+ + T E R + N+KFW H Sbjct: 204 GHSSSRKVSYSQRSFKKPATSSTQYQDTSVE-RLIREVTNEKFWRH 248 >At5g01310.1 68418.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain, weak hit to PF01661: Appr-1-p processing enzyme family Length = 912 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/36 (27%), Positives = 23/36 (63%) Frame = +1 Query: 325 NQKFWTHHNTRFFQEREDYLKKNLPEGQQNLSADEM 432 N+K W T FF++ D L++ +G+ N++++++ Sbjct: 830 NKKHWNSFTTSFFRDSVDVLEEVNSQGKANVASEDL 865 >At3g49500.1 68416.m05410 RNA-dependent RNA polymerase (SDE1) identical to RNA-dependent RNA polymerase [Arabidopsis thaliana] gi|8248473|gb|AAF74208 Length = 1196 Score = 29.5 bits (63), Expect = 1.7 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 343 HHNTRFFQEREDYLKKNLPEGQQNLSADEMSVFYKAFLDKNWKAHISYNIEWYKKILSY* 522 H +E ++ +P+ +NLS +E ++ Y+ W H++Y+ EW KK L Sbjct: 1089 HSYNSLKKEFRKVFEETIPD-HENLSEEEKNILYEKKASA-WY-HVTYHPEWVKKSLELQ 1145 Query: 523 D 525 D Sbjct: 1146 D 1146 >At5g43140.1 68418.m05266 peroxisomal membrane 22 kDa family protein contains Mpv17 / PMP22 family domain, Pfam:PF04117 Length = 254 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 439 IHSFRQLTNFVVPQVNSSSNNL 374 IH R+ NFV+P+V S S NL Sbjct: 43 IHELRKTGNFVIPRVFSVSRNL 64 >At3g27260.1 68416.m03407 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 813 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +1 Query: 241 TKGNFKQPTNETKMEKTYREMRTEVQEFNQKFWTHHNTRFFQEREDYLKKNLPE 402 T G F+ + ET + + +K W+H ++ FQ D +K N+P+ Sbjct: 157 TSGKFES-SKETMTSTPNITLMKQCDTLLRKLWSHPHSWVFQAPVDVVKLNIPD 209 >At5g60530.1 68418.m07590 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 439 Score = 27.5 bits (58), Expect = 7.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 532 KPSLNNLKSSCTIQCCTRCELSNFYLKTLC 443 KP+ N C I C +CE + + KT C Sbjct: 174 KPTKNKNTKGCFIDCTNKCEATCKWRKTNC 203 >At5g03000.1 68418.m00245 kelch repeat-containing F-box family protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 354 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -1 Query: 445 CRIHSFRQLTNFVVPQVNSSSNNLLFPEKILYYGASKT 332 CR H R+L N +P+V+++++ + KI G SK+ Sbjct: 164 CRSHQCRRLPNMALPRVSAAAD--VIDGKIYVVGGSKS 199 >At3g22030.1 68416.m02779 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function; weak similarity to receptor-like protein kinase homolog RK20-1 (GI:4530126) [Phaseolus vulgaris] Length = 253 Score = 27.5 bits (58), Expect = 7.0 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = -1 Query: 562 IFNNFLSLTCKPSLNNLKSSCTIQCCTRCELSNFYLKTLCRIHSFRQLTNFVVPQVNSSS 383 +F+++ C S + L I C + L+N YL CR+ ++ TN +V++ Sbjct: 1 MFSSYSLCKCLVSFHILAIQVLISCASSLNLTNEYLNHKCRV--IKENTN---QEVSTRK 55 Query: 382 NNLLFPEKIL 353 N+ L ++L Sbjct: 56 NSTLSAVELL 65 >At5g47990.1 68418.m05929 cytochrome P450 family protein similar to Cytochrome P450 93A3 (P450 CP5) (SP:O81973) [Glycine max]; Length = 511 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 409 QNLSADEMSVFYKAFLDKNWK 471 +N+ ADE+ FYK LDK K Sbjct: 156 RNIRADELERFYKTLLDKAMK 176 >At3g02570.1 68416.m00248 phosphomannose isomerase type I family protein contains Pfam profile: PF01238 phosphomannose isomerase type I Length = 432 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 224 PADRPYHLRSSSDLEFER 171 PAD HLRSSSDL+ R Sbjct: 404 PADTEIHLRSSSDLKLYR 421 >At1g77980.1 68414.m09087 MADS-box family protein MADS-box protein AGL66 Length = 332 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 131 YLL--LRQLNTNDSKCVQIPNPKKISSDMVGPPDPVSNLRRVILNSLQTKRKW 283 YLL L+QL + +Q+ NP I+SD+ V L++ +L + + RK+ Sbjct: 98 YLLRTLQQLKAENDIALQLTNPTAINSDVEELEHEVYKLQQQLLMAEEELRKY 150 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,639,275 Number of Sequences: 28952 Number of extensions: 213131 Number of successful extensions: 628 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -