BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30260 (732 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 2.4 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 2.4 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 25 3.2 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 25 3.2 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 25 3.2 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 3.2 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 25 3.2 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 25 3.2 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 4.2 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 7.4 AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding pr... 23 7.4 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 7.4 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 9.7 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 25.0 bits (52), Expect = 2.4 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 595 LQRMNAPEWKLTVVASASIIP*HSELTLPLGH 690 L R+ P WK V S P H +P+GH Sbjct: 731 LARVGRPGWKWMSVRPRSPQPHHGHGGIPVGH 762 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 25.0 bits (52), Expect = 2.4 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 92 SDRERSRSRTRNGSR 136 S R RSRSR+R+GSR Sbjct: 1160 SRRSRSRSRSRSGSR 1174 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 645 VDYSITQRAHTPTRASTWANL 707 +D + T H PT +TW++L Sbjct: 223 IDPTATTTTHAPTTTTTWSDL 243 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 645 VDYSITQRAHTPTRASTWANL 707 +D + T H PT +TW++L Sbjct: 223 IDPTATTTTHAPTTTTTWSDL 243 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 645 VDYSITQRAHTPTRASTWANL 707 +D + T H PT +TW++L Sbjct: 222 IDPTATTTTHAPTTTTTWSDL 242 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 645 VDYSITQRAHTPTRASTWANL 707 +D + T H PT +TW++L Sbjct: 222 IDPTATTTTHVPTTTTTWSDL 242 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 645 VDYSITQRAHTPTRASTWANL 707 +D + T H PT +TW++L Sbjct: 223 IDPTATTTTHVPTTTTTWSDL 243 Score = 23.8 bits (49), Expect = 5.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 648 DYSITQRAHTPTRASTWANL 707 D + T H PT +TW++L Sbjct: 191 DSTATTTTHAPTTTTTWSDL 210 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.6 bits (51), Expect = 3.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 645 VDYSITQRAHTPTRASTWANL 707 +D + T H PT +TW++L Sbjct: 223 IDPTATTTTHAPTTTTTWSDL 243 Score = 23.4 bits (48), Expect = 7.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 648 DYSITQRAHTPTRASTWANL 707 D + T H PT +TW++L Sbjct: 191 DPTATTTTHAPTTTTTWSDL 210 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 24.2 bits (50), Expect = 4.2 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 568 TLRTWKMLRLQRMNAPEWKLTVVASASIIP*HSELTLPLGHLH 696 TLR + L APE TV +A +IP + + +P+ LH Sbjct: 371 TLRKYPPLETVT-RAPEHDYTVPGTAHVIPKGTMIQIPIYALH 412 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 7.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 648 DYSITQRAHTPTRASTWANL 707 D + T H PT +TW++L Sbjct: 191 DPTATTTTHAPTTTTTWSDL 210 >AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding protein AgamOBP11 protein. Length = 192 Score = 23.4 bits (48), Expect = 7.4 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = -2 Query: 701 CPCRCPSGSVSSLCYGIIDADATTVNFHSGAFILCNLSIFHVLKV 567 CP RC + LC+ A +FH +L H LK+ Sbjct: 145 CPDRCTAAYKQELCFQEPIAKYLDYHFHDLVGLLHQAKCSHDLKM 189 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 510 CNGSILRKDMVYLLFSCIKTKSKNPEAPRG 421 C I + +CI+ +S+NP +P G Sbjct: 64 CENKIQADQYNLVPLTCIRWRSQNPASPAG 93 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 645 VDYSITQRAHTPTRASTWAN 704 +D + T H PT +TW++ Sbjct: 223 IDPTATTTTHAPTTTTTWSD 242 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,854 Number of Sequences: 2352 Number of extensions: 14310 Number of successful extensions: 38 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -