BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30260 (732 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 50 2e-06 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 49 3e-06 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 48 5e-06 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 48 5e-06 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 48 5e-06 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 48 6e-06 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 48 6e-06 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 48 8e-06 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 48 8e-06 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 46 3e-05 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 46 3e-05 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 45 6e-05 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 44 1e-04 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 44 1e-04 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 44 1e-04 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 44 1e-04 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 43 2e-04 At1g71800.1 68414.m08298 cleavage stimulation factor, putative s... 43 2e-04 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 42 3e-04 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 42 3e-04 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 42 3e-04 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 42 3e-04 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 42 3e-04 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 42 3e-04 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 42 4e-04 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 42 4e-04 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 42 4e-04 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 42 4e-04 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 42 6e-04 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 42 6e-04 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 41 7e-04 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 41 0.001 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 40 0.001 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 40 0.002 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 40 0.002 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 40 0.002 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 40 0.002 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 40 0.002 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 39 0.003 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 39 0.003 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 39 0.003 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 38 0.005 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 38 0.005 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 38 0.007 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 38 0.007 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 38 0.007 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 38 0.009 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 38 0.009 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 38 0.009 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 37 0.012 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 37 0.012 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 37 0.012 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 37 0.012 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 37 0.012 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 37 0.016 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 36 0.021 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 36 0.021 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 36 0.021 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 36 0.021 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 36 0.021 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 36 0.028 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 36 0.037 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 36 0.037 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 36 0.037 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 35 0.048 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 35 0.064 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 35 0.064 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 34 0.085 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 34 0.085 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 34 0.085 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 34 0.085 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 34 0.085 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 34 0.085 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 34 0.085 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 33 0.15 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 33 0.15 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 33 0.15 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 33 0.15 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 33 0.15 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 33 0.15 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 33 0.20 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 33 0.20 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 33 0.20 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 33 0.26 At5g51300.2 68418.m06360 splicing factor-related contains simila... 32 0.34 At5g51300.1 68418.m06359 splicing factor-related contains simila... 32 0.34 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 32 0.34 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 32 0.34 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 32 0.34 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 32 0.34 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 32 0.34 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 32 0.34 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 31 0.60 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 31 0.60 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 31 0.60 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 31 0.60 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 31 0.60 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 31 0.60 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 31 0.60 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 31 0.60 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 0.79 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 31 0.79 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 31 1.0 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 31 1.0 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 31 1.0 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 31 1.0 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 31 1.0 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 30 1.4 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 30 1.4 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 30 1.4 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 30 1.4 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 30 1.4 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 30 1.4 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 30 1.4 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 30 1.8 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 29 2.4 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 29 2.4 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 29 2.4 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 29 2.4 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 29 3.2 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 29 3.2 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 29 3.2 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 29 3.2 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 29 3.2 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 29 3.2 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 29 3.2 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 29 3.2 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 29 3.2 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 29 4.2 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 29 4.2 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 29 4.2 At1g51680.2 68414.m05823 4-coumarate--CoA ligase 1 / 4-coumaroyl... 29 4.2 At1g51680.1 68414.m05822 4-coumarate--CoA ligase 1 / 4-coumaroyl... 29 4.2 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 29 4.2 At5g12190.1 68418.m01430 RNA recognition motif (RRM)-containing ... 28 5.6 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 28 5.6 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 28 7.3 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 28 7.3 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 27 9.7 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 27 9.7 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 27 9.7 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 27 9.7 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQR 668 ++++D +TGRSRGF FV F E+A A + G ++ GRRIRV+Y+ T+R Sbjct: 64 KIIVDRETGRSRGFAFVTFTSTEEASNAM-QLDGQDLHGRRIRVNYA-TER 112 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 439 VFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFT 570 V G+S T E + FSKYG V K+ + + GFA T Sbjct: 38 VGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVT 81 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 49.2 bits (112), Expect = 3e-06 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = +3 Query: 489 F*VWTRCK-VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 F V++ C +V+ D KTGRSRGF FV F + +DA+ A NE G + R+IR +++ Sbjct: 164 FSVFSSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWLSSRQIRCNWA 220 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +V++D +TGRSRGF FV F D A A +E G E++GR IRV+ Sbjct: 65 KVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVN 109 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +V++D +TGRSRGF FV F D A A +E G E++GR IRV+ Sbjct: 65 KVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVN 109 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 48.4 bits (110), Expect = 5e-06 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = +3 Query: 489 F*VWTRCK-VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 F V+ C +V+ D KTGRSRGF FV F + +DA+ A +E TG + R+IR +++ Sbjct: 159 FSVYPTCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAIDEITGKWLGSRQIRCNWA 215 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +1 Query: 421 PSRCLGVF--GLSLYTTEQQINHIFSKYGPVAKCKL 522 PS C V+ + + TE + +F+ GPV CKL Sbjct: 50 PSTCRSVYVGNIHIQVTEPLLQEVFAGTGPVESCKL 85 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTP 680 V+ D +TGRSRGF FV F + A A E G E++GR+IRV+ + T+R+ P Sbjct: 66 VIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA-TERSSAP 118 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTP 680 V+ D +TGRSRGF FV F + A A E G E++GR+IRV+ + T+R+ P Sbjct: 66 VIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA-TERSSAP 118 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 47.6 bits (108), Expect = 8e-06 Identities = 22/47 (46%), Positives = 32/47 (68%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 +V+ D KTGRSRGF FV F + +DA+ A NE G + R+IR +++ Sbjct: 182 RVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWA 228 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +1 Query: 421 PSRCLGVFGLSLYT--TEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFTLRTWKMLR 594 P+ C V+ +++T TE + IF+ GP+ CK L+++ GF + R + Sbjct: 59 PTTCRSVYAGNIHTQVTEILLQEIFASTGPIESCK--LIRKDKSSYGFVHYFDRRCASMA 116 Query: 595 LQRMN 609 + +N Sbjct: 117 IMTLN 121 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 47.6 bits (108), Expect = 8e-06 Identities = 22/47 (46%), Positives = 32/47 (68%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 +V+ D KTGRSRGF FV F + +DA+ A NE G + R+IR +++ Sbjct: 178 RVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWA 224 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +1 Query: 421 PSRCLGVFGLSLYT--TEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFTLRTWKMLR 594 P+ C V+ +++T TE + IF+ GP+ CK L+++ GF + R + Sbjct: 59 PTTCRSVYAGNIHTQVTEILLQEIFASTGPIESCK--LIRKDKSSYGFVHYFDRRCASMA 116 Query: 595 LQRMN 609 + +N Sbjct: 117 IMTLN 121 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 46.0 bits (104), Expect = 3e-05 Identities = 28/69 (40%), Positives = 36/69 (52%) Frame = +3 Query: 501 TRCKVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTP 680 TRC V ID KT SRGF FV F EDA+ A N+ G D +RV++S + P Sbjct: 201 TRC--HVAIDQKTSMSRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVEWSTPKTQLDP 258 Query: 681 TRASTWANL 707 + + NL Sbjct: 259 FSFADYNNL 267 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/42 (45%), Positives = 29/42 (69%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRI 641 +++ID +TGRS+GF FV F+D + + A + G E+DGR I Sbjct: 74 KIIIDRETGRSKGFRFVTFKDEDSMRTAIDRMNGQELDGRNI 115 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 V+V+ D TGRSRGF FV + + + A + G E+DGR +RV+ Sbjct: 120 VEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRVN 165 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/46 (36%), Positives = 30/46 (65%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 + +V+ D +GRS+GF FV ++ ++ + A G ++DGR+IRV Sbjct: 232 EARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRV 277 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 30/47 (63%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 +V++D +TGRSRGF FV F E A A G ++ GR ++V+Y+ Sbjct: 70 RVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYA 116 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/49 (46%), Positives = 30/49 (61%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 +V V ID KTG SRGF FV F EDA+ A N+ G D +RV+++ Sbjct: 241 RVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWA 289 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/49 (40%), Positives = 32/49 (65%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 + Q+V+D + RS+GF FV F ++A+ A E G +++GR I VDY+ Sbjct: 62 EAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYA 110 Score = 29.1 bits (62), Expect = 3.2 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +1 Query: 433 LGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQR---RAVPEGFASF 567 L + GLS TTEQ ++ FSK G V + ++ +M R R+ GF +F Sbjct: 36 LFIGGLSFCTTEQGLSEAFSKCGQVVEAQI-VMDRVSDRSKGFGFVTF 82 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/45 (40%), Positives = 30/45 (66%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +V+ + TGRSRGF F+ FE E+ + A G+E++GR +R++ Sbjct: 249 KVIYERNTGRSRGFGFISFESAENVQSALATMNGVEVEGRALRLN 293 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDY 653 VQ+V D T RSRGF FV +E+AK A +I GR ++V++ Sbjct: 145 VQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKVNF 191 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/47 (42%), Positives = 30/47 (63%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 + +VV D +TGRSRGF FV D+++ A + G ++GR IRV+ Sbjct: 272 EARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVN 318 Score = 33.1 bits (72), Expect = 0.20 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRA 689 +V+ + +T +SRGF FV +++A+ A + +++GR + V+ R P RA Sbjct: 180 EVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVN-KAAPRGSRPERA 236 >At1g71800.1 68414.m08298 cleavage stimulation factor, putative similar to cleavage stimulation factor 64 kilodalton subunit GB:AAD47839 GI:5713194 from [Drosophila melanogaster], SP|P33240 Cleavage stimulation factor, 64 kDa subunit {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 461 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/57 (33%), Positives = 34/57 (59%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTR 686 ++V D +TG+ +G+ F ++D E A A+ EI+GR++RVD++ + TR Sbjct: 39 RLVTDRETGKPKGYGFCEYKDEETALSARRNLQSYEINGRQLRVDFAENDKGTDKTR 95 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = +1 Query: 403 LLENTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGF 558 + +++ RC+ V + TE+Q+ I + GPV +L + P+G+ Sbjct: 1 MASSSSQRRCVFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGY 52 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/45 (44%), Positives = 30/45 (66%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +++ D ++GRSRGF FV F+D + + A E G E+DGR I V+ Sbjct: 36 KIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVN 80 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/45 (44%), Positives = 30/45 (66%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +++ D ++GRSRGF FV F+D + + A E G E+DGR I V+ Sbjct: 36 KIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVN 80 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/45 (44%), Positives = 30/45 (66%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +++ D ++GRSRGF FV F+D + + A E G E+DGR I V+ Sbjct: 36 KIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVN 80 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/47 (42%), Positives = 30/47 (63%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 + +VV+D +GRSRGF F+ F++ + A GM++DGR I VD Sbjct: 35 EAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVD 81 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/45 (44%), Positives = 29/45 (64%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +++ D +TGRSRGF FV F+D + K A G ++DGR I V+ Sbjct: 38 KIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVN 82 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/45 (44%), Positives = 29/45 (64%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +++ D +TGRSRGF FV F+D + K A G ++DGR I V+ Sbjct: 38 KIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVN 82 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 + +V+ D +GRS+GF FV ++ + A N G ++DGR+IRV Sbjct: 277 EARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRV 322 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 V+V+ D TGRSRGF FV + + A + G E +GR +RV+ Sbjct: 128 VEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRVN 173 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/46 (39%), Positives = 29/46 (63%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 + +V+ D +GRS+GF FV ++ + A N G ++DGR+IRV Sbjct: 285 EARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRV 330 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 V+V+ D TGRSRGF FV + + A + G E +GR +RV+ Sbjct: 128 VEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRVN 173 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/57 (36%), Positives = 32/57 (56%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTP 680 KVQV+ D +GRSR F F + +EDA + G ++GR I+V+ + A +P Sbjct: 104 KVQVMYDKYSGRSRRFGFATMKSVEDANAVVEKLNGNTVEGREIKVNITEKPIASSP 160 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +VV D TGRSRG+ FV + + + A G E++GR IRV+ Sbjct: 207 RVVFDGDTGRSRGYGFVCYSSKAEMETALESLDGFELEGRAIRVN 251 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/48 (37%), Positives = 30/48 (62%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 V+V+ + TG+SRGF FV ++ED I + G E GR ++V+++ Sbjct: 114 VEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFA 161 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 41.5 bits (93), Expect = 6e-04 Identities = 21/52 (40%), Positives = 30/52 (57%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRA 671 +VVID+ TGRS+G+ FV F D + A E G R++RV + +RA Sbjct: 233 KVVIDSNTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIATPKRA 284 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 41.5 bits (93), Expect = 6e-04 Identities = 21/52 (40%), Positives = 30/52 (57%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRA 671 +VVID+ TGRS+G+ FV F D + A E G R++RV + +RA Sbjct: 244 KVVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRA 295 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +V +V D T + +G+ F+ + D K A + G +IDGRR+ VD Sbjct: 166 RVHLVTDQLTNKPKGYAFIEYMHTRDMKAAYKQADGQKIDGRRVLVD 212 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 421 PSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFA 561 P + L V L+ ++E +I F YGP+ + L Q P+G+A Sbjct: 136 PYKTLFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYA 182 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAH 674 V ++ D TG+S+GF F+ +ED +A + G + GR I+VD+ + H Sbjct: 65 VNLIRDKGTGKSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKVDHCGAYKKH 118 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/50 (38%), Positives = 31/50 (62%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSI 659 +V++ D +GRSRGF FV F + DA AK+ G + GR +R+ +++ Sbjct: 69 EVRIAYDKGSGRSRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFAL 118 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 412 NTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL 522 + +PS L + GLS EQ + FS +G VA+ ++ Sbjct: 36 SASPSSKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRI 72 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +VV+DA TGRS+G+ FV F D + A E G++ R +R+ Sbjct: 230 KVVLDANTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 273 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +VV+DA TGRS+G+ FV F D + A E G++ R +R+ Sbjct: 228 KVVLDANTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +VV+DA TGRS+G+ FV F D + A E G++ R +R+ Sbjct: 228 KVVLDANTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/49 (42%), Positives = 29/49 (59%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSI 659 V+V D T RS G+ +V + +DA A NE M ++GR IRV YS+ Sbjct: 74 VRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSV 122 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +3 Query: 489 F*VWTRCKVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGR 635 F V T C V++ G+S+GF FV FE+ +DA A + G D + Sbjct: 247 FGVTTSC---VIMRDGEGKSKGFGFVNFENSDDAARAVDALNGKTFDDK 292 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 39.5 bits (88), Expect = 0.002 Identities = 22/59 (37%), Positives = 30/59 (50%) Frame = +3 Query: 501 TRCKVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHT 677 T V+V + +TG SRG +V + AKIA G E+ GR +RV YS+ T Sbjct: 133 TVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDMNPGT 191 Score = 31.9 bits (69), Expect = 0.45 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +3 Query: 501 TRCKVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 T +V+ D KTGR+R F F+ F E+ A + G + +GRRI V Sbjct: 237 TIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS-FNGTQYEGRRIIV 284 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +VV D +TGRSRGF FV + + +A G ++GR I+V+ Sbjct: 237 RVVSDRETGRSRGFGFVQMSNENEVNVAIAALDGQNLEGRAIKVN 281 Score = 36.3 bits (80), Expect = 0.021 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTR 686 +V+ + T +SRGF FV +E+A+ A + E++GRR+ V+ + R P R Sbjct: 143 EVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRA-APRGSRPER 198 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/45 (44%), Positives = 28/45 (62%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +V+ D +GRS+GF FV + +EDA+ AK E +DG I VD Sbjct: 64 RVITDRDSGRSKGFGFVTYATIEDAEKAKAEMNAKFLDGWVIFVD 108 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 39.1 bits (87), Expect = 0.003 Identities = 25/61 (40%), Positives = 34/61 (55%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRAS 692 VQV D +TG +GF FV F +EDA+ A N +EI GR I+V ++T + P Sbjct: 314 VQVPRD-ETGLCKGFGFVQFARLEDARNALNLNGQLEIAGRAIKVS-AVTDQTEVPEAGQ 371 Query: 693 T 695 T Sbjct: 372 T 372 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTG-MEIDGRRIRV 647 VQ+ +D +TG+ +GF F+ F +E +K A+ G +EI GR I+V Sbjct: 294 VQLPLDPETGQCKGFGFIQFVQLEHSKAAQIALNGKLEIAGRTIKV 339 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTP 680 V+ D TGRS+G+ FV F D E A+ A + T + IDGRR + + R+ P Sbjct: 55 VITDKNTGRSKGYGFVTFRDPEAARRACVDPTPI-IDGRRANCNLASLGRSRPP 107 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDY 653 K+ + +D T GFCFV F ED + A +G +D R IRVD+ Sbjct: 62 KIIMGLDKNTKTPCGFCFVLFYSREDTEDAVKYISGTILDDRPIRVDF 109 Score = 31.1 bits (67), Expect = 0.79 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 448 LSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGF 558 +S YTTE+Q+ +FS+ G + K + L + P GF Sbjct: 41 VSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGF 77 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 37.9 bits (84), Expect = 0.007 Identities = 24/64 (37%), Positives = 31/64 (48%) Frame = +1 Query: 394 RVRLLENTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFTL 573 R R E P L V GLS T++ + F+K G VA C L + R V GFA T+ Sbjct: 60 RSRGSEVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTM 119 Query: 574 RTWK 585 + K Sbjct: 120 SSLK 123 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 37.9 bits (84), Expect = 0.007 Identities = 22/54 (40%), Positives = 30/54 (55%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTP 680 V+ D TGRS+G+ FV F D E A+ A + T + IDGRR + + R P Sbjct: 55 VIADKNTGRSKGYGFVTFRDPEAARRACADPTPI-IDGRRANCNLASLGRPRPP 107 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.5 bits (83), Expect = 0.009 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +3 Query: 528 DAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 D +TG SRGF FV ++ ++A A G +DGR I V ++ Sbjct: 50 DRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFA 92 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.5 bits (83), Expect = 0.009 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +3 Query: 528 DAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 D +TG SRGF FV ++ ++A A G +DGR I V ++ Sbjct: 50 DRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFA 92 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 37.5 bits (83), Expect = 0.009 Identities = 21/65 (32%), Positives = 33/65 (50%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRAST 695 +VV+D TGRS+G+ FV F D + A E G R +R+ + + A P + + Sbjct: 185 KVVLDRTTGRSKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRIGPAANKNA-LPMQPAM 243 Query: 696 WANLQ 710 + N Q Sbjct: 244 YQNTQ 248 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 37.1 bits (82), Expect = 0.012 Identities = 22/59 (37%), Positives = 29/59 (49%) Frame = +1 Query: 409 ENTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFTLRTWK 585 E P L V GLS T++ + F+K G VA C L + R V GFA T+ + K Sbjct: 66 EVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLK 124 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +3 Query: 534 KTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHT 677 K R+RG F+ E+A A E +GRR++VDY+ T++ T Sbjct: 129 KKERNRGLVFIEMASPEEAATALKSLESCEYEGRRLKVDYAKTKKKKT 176 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 37.1 bits (82), Expect = 0.012 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 VV+D ++G SRGF FV ++ +E A A E+DGR I V Sbjct: 67 VVLDRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGV 109 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 37.1 bits (82), Expect = 0.012 Identities = 20/59 (33%), Positives = 32/59 (54%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRAS 692 +VVID TGR++G+ FV F D + A E G+ R +R+ + +++ T R S Sbjct: 186 KVVIDRVTGRTKGYGFVRFSDESEQIRAMTEMNGVPCSTRPMRIGPAASKKGVTGQRDS 244 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 37.1 bits (82), Expect = 0.012 Identities = 20/59 (33%), Positives = 32/59 (54%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRAS 692 +VVID TGR++G+ FV F D + A E G+ R +R+ + +++ T R S Sbjct: 186 KVVIDRVTGRTKGYGFVRFSDESEQIRAMTEMNGVPCSTRPMRIGPAASKKGVTGQRDS 244 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 36.7 bits (81), Expect = 0.016 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 V+ D T RSRGF FV + +A+ A + G E++GRR+ V Sbjct: 34 VMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSV 76 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 36.3 bits (80), Expect = 0.021 Identities = 16/47 (34%), Positives = 29/47 (61%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 + +++ D++T R +GF F+ F+ +DA+ A G +DGR I V+ Sbjct: 35 EARLIRDSETQRPKGFGFITFDSEDDARKALKSLDGKIVDGRLIFVE 81 Score = 32.7 bits (71), Expect = 0.26 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 433 LGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFT 570 L V LS YTT+Q + +FS +G + + +L P+GF T Sbjct: 9 LFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFIT 54 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 36.3 bits (80), Expect = 0.021 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +3 Query: 534 KTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 + GRS+GF FV F + E++K AK G +DG+ I V Sbjct: 339 ENGRSKGFGFVCFSNCEESKQAKRYLNGFLVDGKPIVV 376 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 VV+ GRSRGF FV F + E+AK A G+++ +++ V Sbjct: 232 VVMRDGMGRSRGFGFVNFCNPENAKKAMESLCGLQLGSKKLFV 274 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 36.3 bits (80), Expect = 0.021 Identities = 21/56 (37%), Positives = 32/56 (57%) Frame = +1 Query: 403 LLENTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFT 570 LL + + S L V G+S +TE+ + FS+YG V K + + + R P+GFA T Sbjct: 13 LLFSRSFSSTLFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVT 68 Score = 35.5 bits (78), Expect = 0.037 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTP 680 KV V++D R +GF +V F E+A+ A E +DGR + +D + + + P Sbjct: 49 KVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVVILDTTKAAKHNPP 105 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 36.3 bits (80), Expect = 0.021 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = +3 Query: 501 TRCKVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 T V+ D KTG S + F+ FE+ E + A + ID RRI VD+S Sbjct: 268 TVVSADVIRDFKTGDSLCYAFIEFENKESCEQAYFKMDNALIDDRRIHVDFS 319 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 36.3 bits (80), Expect = 0.021 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQR 668 V+ +D + R F FV F + EDA A + G E+ GR + V+Y++ ++ Sbjct: 42 VKTPLDQANQKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTVNYALPEK 93 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 35.9 bits (79), Expect = 0.028 Identities = 19/54 (35%), Positives = 34/54 (62%) Frame = +3 Query: 507 CKVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQR 668 CKV + + TGRS+G+ FV FE E A+ A ++ GM ++ +++ V + I ++ Sbjct: 165 CKVAMDV---TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIRRQ 215 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 35.5 bits (78), Expect = 0.037 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +3 Query: 519 VVIDAKTG-RSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSI-TQRAHTPTRAS 692 V ID K R G+ FV F+D DA+ A + G + DG R+RV+ + +R+ TR S Sbjct: 34 VQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGGRRSSDDTRGS 93 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 424 SRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFA 561 SR + V L E+++ +FSKYGPV + L + R P G+A Sbjct: 6 SRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR---PPGYA 48 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 35.5 bits (78), Expect = 0.037 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +3 Query: 519 VVIDAKTG-RSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSI-TQRAHTPTRAS 692 V ID K R G+ FV F+D DA+ A + G + DG R+RV+ + +R+ TR S Sbjct: 34 VQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGGRRSSDDTRGS 93 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 424 SRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFA 561 SR + V L E+++ +FSKYGPV + L + R P G+A Sbjct: 6 SRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR---PPGYA 48 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 35.5 bits (78), Expect = 0.037 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +3 Query: 519 VVIDAKTG-RSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSI-TQRAHTPTRAS 692 V ID K R G+ FV F+D DA+ A + G + DG R+RV+ + +R+ TR S Sbjct: 34 VQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGGRRSSDDTRGS 93 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 424 SRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFA 561 SR + V L E+++ +FSKYGPV + L + R P G+A Sbjct: 6 SRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR---PPGYA 48 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 35.1 bits (77), Expect = 0.048 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYF--EDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRA 689 Q++ D TGRSRGF FV + EDM D +AK +E+ G ++ + + ++ ++ T Sbjct: 160 QIMRDHSTGRSRGFGFVTYESEDMVDHLLAKG--NRIELSGTQVEIKKAEPKKPNSVTTP 217 Query: 690 S 692 S Sbjct: 218 S 218 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 34.7 bits (76), Expect = 0.064 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDY 653 V+++ + +T +S G+ +V+F EDA+ A G DGR I V + Sbjct: 106 VKIIANERTRQSLGYGYVWFNSKEDAQSAVEAMNGKFFDGRFILVKF 152 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 34.7 bits (76), Expect = 0.064 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +1 Query: 412 NTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFA 561 + TPS + V GLS+ +TE+ + I +++GP+ ++ Q + GFA Sbjct: 293 SATPSATVVVKGLSMKSTEEDLYQILAEWGPLHHVRVIREQNSGISRGFA 342 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAK--IAKNECTGMEIDGRRIRVDYS 656 V+V+ + +G SRGF F+ F ++ A+ + + E G+ +DGR++ YS Sbjct: 327 VRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEHDGIVLDGRKLMFHYS 376 Score = 33.9 bits (74), Expect = 0.11 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDA--KIAKNECTGMEIDGRRIRVDYS 656 +++V D T SRGF FV+F +EDA + T +E +G+ +RV Y+ Sbjct: 487 LRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYA 536 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +1 Query: 406 LENTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFA 561 + T P+ L V GL E+ + + FSK+ P+ +L + V GFA Sbjct: 451 ISETGPTHVLVVRGLDEDADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFA 502 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 34.3 bits (75), Expect = 0.085 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRAS 692 +++ D +T R +GF F+ FE +DA+ A G ++GR I V+ + A T + S Sbjct: 96 RLIKDQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETAKEVEAPTTSLKS 154 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/65 (29%), Positives = 32/65 (49%) Frame = +1 Query: 385 LGDRVRLLENTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFAS 564 + R RL+ T + C+ GLS YTT+Q + +F+ + + K Q+ P+GF Sbjct: 58 ISKRRRLIGGKTLT-CVSNSGLSAYTTDQSLRQLFAPFARLIK-----DQQTQRPKGFGF 111 Query: 565 FTLRT 579 T + Sbjct: 112 ITFES 116 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 34.3 bits (75), Expect = 0.085 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGME--IDGRRIRVDYSI--TQRAHTPT 683 V+ D TGRS+G+ FV F ++A+ A C M IDGRR + + Q+ PT Sbjct: 53 VITDKNTGRSKGYGFVTF---KEAEAAMRACQNMNPVIDGRRANCNLACLGAQKPRPPT 108 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 34.3 bits (75), Expect = 0.085 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 522 VIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTP 680 +I K G++RGF FV E+A+ A ++ ++ GR I V ++ + TP Sbjct: 126 IIRQKDGKNRGFAFVTMASGEEAQAAIDKFDTFQVSGRIISVSFARRFKKPTP 178 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 34.3 bits (75), Expect = 0.085 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRR 638 V+ D +GRS+G+ FV F + E A+ A + T + IDGRR Sbjct: 44 VITDKASGRSKGYGFVTFREAEAARSACVDATPV-IDGRR 82 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 34.3 bits (75), Expect = 0.085 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRR 638 V+ D +GRS+G+ FV F + E A+ A + T + IDGRR Sbjct: 44 VITDKASGRSKGYGFVTFREAEAARSACVDATPV-IDGRR 82 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 34.3 bits (75), Expect = 0.085 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRR 638 V+ D +GRS+G+ FV F + E A+ A + T + IDGRR Sbjct: 44 VITDKASGRSKGYGFVTFREAEAARSACVDATPV-IDGRR 82 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 34.3 bits (75), Expect = 0.085 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPT 683 V +V+D T SRGF F+ + + DA + GR I V+ + +R TPT Sbjct: 104 VHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKARRRRGRTPT 160 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 + +V+ + TGRSRG+ FV F + A A + G E++G I V+ Sbjct: 59 EARVMTNKVTGRSRGYGFVNFISEDSANSAISAMNGQELNGFNISVN 105 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 33.5 bits (73), Expect = 0.15 Identities = 20/41 (48%), Positives = 22/41 (53%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRI 641 V+ D TGRSRGF +V F ED AKN G G RI Sbjct: 34 VMKDRSTGRSRGFGYVTFASAED---AKNALKGEHFLGNRI 71 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 V+V DA T S G+ +V + + +DA+ A + ++G+ IR+ YS Sbjct: 75 VRVCRDAATNTSLGYGYVNYSNTDDAEKAMQKLNYSYLNGKMIRITYS 122 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGR 635 VV+ G+SR F FV FE+ EDA A G + D + Sbjct: 255 VVMRDGDGKSRCFGFVNFENPEDAARAVEALNGKKFDDK 293 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 439 VFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFT 570 V GLS TE+Q+ F +YG + +C++ + + P GF T Sbjct: 16 VGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFIT 59 Score = 32.7 bits (71), Expect = 0.26 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +3 Query: 501 TRCKVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 T C Q+++ TGR RGF F+ F D A A G E+ + I V+ Sbjct: 39 TEC--QIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVN 86 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 439 VFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFT 570 V GLS TE+Q+ F +YG + +C++ + + P GF T Sbjct: 16 VGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFIT 59 Score = 32.7 bits (71), Expect = 0.26 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +3 Query: 501 TRCKVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 T C Q+++ TGR RGF F+ F D A A G E+ + I V+ Sbjct: 39 TEC--QIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVN 86 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 33.5 bits (73), Expect = 0.15 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 519 VVIDAKTG-RSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPT 683 V ID K R G+ FV FED DA A G + DG R+RV+ + R +P+ Sbjct: 34 VDIDLKIPPRPPGYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIAHGGRRFSPS 89 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +VV D TGRS+G+ FV F + + A E G+ R +R+ Sbjct: 147 KVVTDPSTGRSKGYGFVKFAEESERNRAMAEMNGLYCSTRPMRI 190 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 33.1 bits (72), Expect = 0.20 Identities = 20/59 (33%), Positives = 28/59 (47%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRAS 692 +VV D TGRS+G+ FV F D + A E G R +R + ++ T AS Sbjct: 204 KVVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQYCSSRPMRTGPAANKKPLTMQPAS 262 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 33.1 bits (72), Expect = 0.20 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +3 Query: 537 TGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQ 665 TG SRG+ FV +E ++ A + IDGR I VDY+ Q Sbjct: 101 TGASRGYGFVEYETEKEMLRAYEDAHHSLIDGREIIVDYNRQQ 143 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIA 599 +V+V + KTG+S+ F F+ FED E A+IA Sbjct: 88 RVRVARNKKTGKSKHFGFIQFEDPEVAEIA 117 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 32.3 bits (70), Expect = 0.34 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +V+ D TG S+G+ FV + D++ A A G +GR + V Sbjct: 510 KVIKDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAV 553 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 32.3 bits (70), Expect = 0.34 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +V+ D TG S+G+ FV + D++ A A G +GR + V Sbjct: 510 KVIKDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAV 553 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 32.3 bits (70), Expect = 0.34 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 Q++++ TGRSRGF F+ F D + E G + R I V+ Sbjct: 37 QIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVN 81 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 439 VFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFT 570 V GLS T++ + FS++G + C++ L + GF T Sbjct: 11 VGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFIT 54 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 32.3 bits (70), Expect = 0.34 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 552 GFCFVYFEDMEDAKIAKNECTGMEI--DGRRIRVDYSITQR 668 GF FVY ED DA+ A E GRR+RV+++ ++R Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEFGRKGRRLRVEWTKSER 76 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 32.3 bits (70), Expect = 0.34 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGR 635 V++D TG+S+G+ FV F ++ A +A E +IDGR Sbjct: 106 VILDKVTGKSKGYGFVTFMHVDGALLALKE-PSKKIDGR 143 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 32.3 bits (70), Expect = 0.34 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGR 635 V++D TG+S+G+ FV F ++ A +A E +IDGR Sbjct: 106 VILDKVTGKSKGYGFVTFMHVDGALLALKE-PSKKIDGR 143 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 32.3 bits (70), Expect = 0.34 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRASTW 698 ++ D TGR+RGF FV F D A+I E IDGR + ++ + S Sbjct: 37 ILKDRTTGRARGFGFVVFADPAVAEIVITE--KHNIDGRLVEAKKAVPRDDQNMVNRSNS 94 Query: 699 ANLQ 710 +++Q Sbjct: 95 SSIQ 98 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 32.3 bits (70), Expect = 0.34 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRASTW 698 ++ D TGR+RGF FV F D A+I E IDGR + ++ + S Sbjct: 37 ILKDRTTGRARGFGFVVFADPAVAEIVITE--KHNIDGRLVEAKKAVPRDDQNMVNRSNS 94 Query: 699 ANLQ 710 +++Q Sbjct: 95 SSIQ 98 >At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing protein Length = 710 Score = 31.5 bits (68), Expect = 0.60 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 +V+ + +G+S+G+C V F D A K+ G +GR V+Y+ Sbjct: 262 EVKFFDEKASGKSKGYCQVEFYDPVAASACKDALNGYPFNGRPCVVEYA 310 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 31.5 bits (68), Expect = 0.60 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +3 Query: 540 GRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQR--AHTPTRASTWAN 704 G++RGF V + D+ A+ A G + GR++ + YSI + + + W N Sbjct: 244 GKNRGFIMVSYYDIRAAQKAARALHGRLLRGRKLDIRYSIPKENPKENSSEGALWVN 300 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 31.5 bits (68), Expect = 0.60 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 519 VVIDAKTG-RSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 V ID K R G+ FV FED DA A G + DG +RV+ Sbjct: 34 VQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGYDFDGHHLRVE 78 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 424 SRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFA 561 SR + V L E+++ +FSKYGPV + L + R P G+A Sbjct: 6 SRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPR---PPGYA 48 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 31.5 bits (68), Expect = 0.60 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 519 VVIDAKTG-RSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 V ID K R G+ FV FED DA A G + DG +RV+ Sbjct: 34 VQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGYDFDGHHLRVE 78 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 424 SRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFA 561 SR + V L E+++ +FSKYGPV + L + R P G+A Sbjct: 6 SRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPR---PPGYA 48 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 31.5 bits (68), Expect = 0.60 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 546 SRGFCFVYFEDMEDAKIAKNECTGMEIDG 632 SRGF F+Y+ +E+A AK G ++G Sbjct: 52 SRGFAFIYYRHVEEAVAAKEALQGANLNG 80 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 31.5 bits (68), Expect = 0.60 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNE 608 VVID TG+++GF FV F+ + AK A E Sbjct: 135 VVIDKATGKAKGFGFVMFKTRKGAKEALKE 164 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/63 (23%), Positives = 28/63 (44%) Frame = +1 Query: 397 VRLLENTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFTLR 576 V + R + V+GL TT + + +F YG + +C + + + +GF + Sbjct: 94 VEAADRDVTHRKIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFK 153 Query: 577 TWK 585 T K Sbjct: 154 TRK 156 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 31.5 bits (68), Expect = 0.60 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNE 608 VVID TG+++GF FV F+ + AK A E Sbjct: 135 VVIDKATGKAKGFGFVMFKTRKGAKEALKE 164 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/63 (23%), Positives = 28/63 (44%) Frame = +1 Query: 397 VRLLENTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFTLR 576 V + R + V+GL TT + + +F YG + +C + + + +GF + Sbjct: 94 VEAADRDVTHRKIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFK 153 Query: 577 TWK 585 T K Sbjct: 154 TRK 156 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 31.5 bits (68), Expect = 0.60 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQ 665 + +V+D R +GF F+ +E E+A A G +DGR I V+ + T+ Sbjct: 106 MNMVMDKVANRPKGFAFLRYETEEEAMKAIQGMHGKFLDGRVIFVEEAKTR 156 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 421 PSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFTLRT 579 P L V GLS TTE + F ++G + + + + P+GFA T Sbjct: 75 PKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYET 127 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 31.1 bits (67), Expect = 0.79 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTG 617 +++ D ++GRSRGF FV F+D + + A E G Sbjct: 36 KIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNG 69 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 31.1 bits (67), Expect = 0.79 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +V V+ D T +SRG FV + EDA A ++GR++ V Sbjct: 85 RVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTV 130 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 552 GFCFVYFEDMEDAKIAKNECTGMEI--DGRRIRVDYSITQR 668 GF FVY ED DA+ A E GRR+RV+++ R Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGRTGRRLRVEWTKNDR 76 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 552 GFCFVYFEDMEDAKIAKNECTGMEI--DGRRIRVDYSITQR 668 GF FVY ED DA+ A E GRR+RV+++ R Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGRTGRRLRVEWTKNDR 76 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGR 635 VV+ G+S+GF FV FE+ +DA A G + D + Sbjct: 59 VVMKDGEGKSKGFGFVNFENADDAARAVESLNGHKFDDK 97 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +V+++ D RS+G+ F+ F +DA +A +GR I +D Sbjct: 68 EVKLIKDEAMKRSKGYAFIQFTSQDDAFLAIETMDRRMYNGRMIYID 114 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 555 FCFVYFEDMEDAKIAKNECTGMEIDGRRIRVD 650 +CFV FE DA+ A G +DG R+RV+ Sbjct: 47 YCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVE 78 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 549 RGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 R + FV F D DA A+ G + DG RI V+ S Sbjct: 44 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEAS 79 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 549 RGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 R + FV F D DA A+ G + DG RI V+ S Sbjct: 3 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEAS 38 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +3 Query: 501 TRCKVQVVIDAKTGRSRGFCFVYFEDMEDAKIA 599 T C V V+D TGR++GF FV F+ + A+ A Sbjct: 190 TECSV--VMDKDTGRAKGFGFVLFKTRKGARAA 220 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/73 (24%), Positives = 32/73 (43%) Frame = +1 Query: 409 ENTTPSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL*LMQRRAVPEGFASFTLRTWKM 588 + + R + V GL TT + + F YG + +C + + + +GF +T K Sbjct: 157 DRDSSQRNIFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKG 216 Query: 589 LRLQRMNAPEWKL 627 R N PE ++ Sbjct: 217 ARAALKN-PEKRM 228 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPT 683 +V + + RGF FV F ED A G + GRRI ++ Q AH P+ Sbjct: 51 LVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTVGGRRI----TVKQAAHRPS 101 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +3 Query: 534 KTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRASTWAN 704 +TG +GF FV F +DA A + G R I VD+++ + + +T A+ Sbjct: 367 ETGLPKGFAFVKFTCKKDAANAIKKFNGHMFGKRPIAVDWAVPKNIYNGAADATTAS 423 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRR 638 V+ D +GRS+G+ FV F D E A+ A + + IDGRR Sbjct: 38 VITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPV-IDGRR 76 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRR 638 V+ D +GRS+G+ FV F D E A+ A + + IDGRR Sbjct: 38 VITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPV-IDGRR 76 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRR 638 ++ D TG+S+G+ FV F D + A A + + IDGR+ Sbjct: 48 IITDKATGKSKGYGFVTFRDSDSATRAVADPNPV-IDGRK 86 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSI 659 V++ DA +GRS + + F +DA +A + ++G+ IRV +S+ Sbjct: 53 VRLCKDASSGRSLCYGYANFLSRQDANLAIEKKNNSLLNGKMIRVMWSV 101 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/53 (35%), Positives = 23/53 (43%) Frame = +3 Query: 537 TGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRAST 695 TG RGF FV + EDA A I GR I + ++ R TP T Sbjct: 84 TGEPRGFGFVKYRYAEDAAEAMKRMNHKVIGGREIAIVFAEENR-KTPQEMRT 135 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 552 GFCFVYFEDMEDAK--IAKNECTGMEIDGRRIRVDYSITQRAHTPTRASTWANLQ 710 G+ FVYFED DA+ I K + + RR+ V+++ +R A +NL+ Sbjct: 36 GYAFVYFEDERDAEDAIRKLDNFPFGYEKRRLSVEWAKGERGRPRGDAKAPSNLK 90 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYF--EDMEDAKIAKNECTGM 620 QV+ D +T RSRGF FV F E++ D ++K M Sbjct: 139 QVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDM 175 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYF--EDMEDAKIAKNECTGM 620 QV+ D +T RSRGF FV F E++ D ++K M Sbjct: 139 QVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDM 175 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 +VV D +G S+GF FV + +ED+ G +DG I +Y+ Sbjct: 86 KVVTDRVSGYSKGFGFVRYATLEDSAKGIAGMDGKFLDGWVIFAEYA 132 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 421 PSRCLGVFGLSLYTTEQQINHIFSKYGPVAKCKL 522 PS L V GLS TT + + F+++G VA K+ Sbjct: 54 PSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKV 87 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +V +V+D +T RSRG ++ + E A A E GR + + Sbjct: 289 EVHLVLDKETKRSRGIAYILYLIPECAARAMEELDNSSFQGRLLHI 334 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 525 IDAKTGRSRGFCFVYFEDMEDAKIAKNE 608 +D TGR +GFC ++ E AK A E Sbjct: 278 LDKYTGRPKGFCLFVYKSSESAKRALEE 305 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 525 IDAKTGRSRGFCFVYFEDMEDAKIAKNE 608 +D TGR +GFC ++ E AK A E Sbjct: 278 LDKYTGRPKGFCLFVYKSSESAKRALEE 305 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 525 IDAKTGRSRGFCFVYFEDMEDAKIAKNE 608 +D TGR +GFC ++ E AK A E Sbjct: 278 LDKYTGRPKGFCLFVYKSSESAKRALEE 305 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRR 638 ++ D T RS+G+ FV F+D + A A + T + I+GRR Sbjct: 48 IISDKLTRRSKGYGFVTFKDAKAATRACEDSTPI-INGRR 86 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYS 656 +V V D +TG SRGF ++ D+ + +G EI G I V+ S Sbjct: 511 RVHVPTDRETGASRGFAYI---DLTSGFDEALQLSGSEIGGGNIHVEES 556 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRR 638 ++ D TG+S+G+ FV F + + A A + + IDGR+ Sbjct: 48 IITDKNTGKSKGYGFVTFRESDSATRAVADPNPV-IDGRK 86 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRR 638 ++ D TG+S+G+ FV F + + A A + + IDGR+ Sbjct: 48 IITDKNTGKSKGYGFVTFRESDSATRAVADPNPV-IDGRK 86 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +V D +TG S+G+ F ++D+ IA G+++ + + V Sbjct: 390 LVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTV 432 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +V D +TG S+G+ F ++D+ IA G+++ + + V Sbjct: 390 LVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTV 432 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRV 647 +V D +TG S+G+ F ++D+ IA G+++ + + V Sbjct: 390 LVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTV 432 >At1g51680.2 68414.m05823 4-coumarate--CoA ligase 1 / 4-coumaroyl-CoA synthase 1 (4CL1) identical to SP|Q42524 4-coumarate--CoA ligase 1 (EC 6.2.1.12) (4CL 1) (4-coumaroyl-CoA synthase 1) {Arabidopsis thaliana} Length = 490 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 650 IDADATTVNFHSGAFILCNLSIFHVLKVN 564 +D + + FHS ILC L +FH+ +N Sbjct: 235 VDGENPNLYFHSDDVILCVLPMFHIYALN 263 >At1g51680.1 68414.m05822 4-coumarate--CoA ligase 1 / 4-coumaroyl-CoA synthase 1 (4CL1) identical to SP|Q42524 4-coumarate--CoA ligase 1 (EC 6.2.1.12) (4CL 1) (4-coumaroyl-CoA synthase 1) {Arabidopsis thaliana} Length = 561 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 650 IDADATTVNFHSGAFILCNLSIFHVLKVN 564 +D + + FHS ILC L +FH+ +N Sbjct: 235 VDGENPNLYFHSDDVILCVLPMFHIYALN 263 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 516 QVVIDAKTGRSRGFCFVYFE 575 Q++ D TGRSRGF FV F+ Sbjct: 187 QIMYDHHTGRSRGFGFVTFQ 206 >At5g12190.1 68418.m01430 RNA recognition motif (RRM)-containing protein similar to SP|P52298 20 kDa nuclear cap binding protein (NCBP 20 kDa subunit) (CBP20) (NCBP interacting protein 1) (NIP1) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 124 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 546 SRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDY 653 ++G FV +ED+ DAK A + +G + R + V Y Sbjct: 56 TKGTAFVVYEDIYDAKNAVDHLSGFNVANRYLIVLY 91 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 28.3 bits (60), Expect = 5.6 Identities = 20/61 (32%), Positives = 30/61 (49%) Frame = +3 Query: 510 KVQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQRAHTPTRA 689 +V V+ + TGR RGF FV F D A I + ID R + V ++++ +P Sbjct: 34 QVTVMREKATGRPRGFGFVAFSD--PAVIDRVLQDKHHIDNRDVDVKRAMSREEQSPAGR 91 Query: 690 S 692 S Sbjct: 92 S 92 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +1 Query: 433 LGVFGLSLYTTEQQINHIFSKYGPVAKCKL*L--MQRRAVPEGFASFTLRTWKMLRLQRM 606 L + GLS YT+E+ + F +G + + K+ + + +R+ F +T L+ M Sbjct: 284 LFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEAAGTALKEM 343 Query: 607 N 609 N Sbjct: 344 N 344 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSITQR 668 V +V+D T SRGF F+ + + DA + GR I V+ + Q+ Sbjct: 74 VHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKFLWQQ 125 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 513 VQVVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTG 617 V+++ + +T +S G+ +V+F EDA+ A G Sbjct: 87 VKIIANERTRQSLGYGYVWFNSKEDAQSAVEAMNG 121 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAK---IAKNECTGMEIDGRRI--RVDYSITQRAHTP 680 ++ D TGR+RGF F+ F D A+ + K+ G ++ ++ R D + +R +P Sbjct: 46 IMRDRTTGRARGFGFIVFADPSVAERVIMDKHIIDGRTVEAKKAVPRDDQQVLKRHASP 104 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +1 Query: 466 EQQINHIFSKYGPVAKCKL*LMQRRAVPE--GFASFTLRTWKMLRLQRMN 609 ++++ +FS+YG V CK+ +M + + GF +++ +L ++ MN Sbjct: 341 DEKLKEMFSEYGNVTSCKV-MMNSQGLSRGFGFVAYSNPEEALLAMKEMN 389 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +3 Query: 519 VVIDAKTGRSRGFCFVYFEDMEDAKIAKNECTGMEIDGRRIRVDYSI 659 +V D +TG S+G+ F ++D IA G+++ + + V +I Sbjct: 406 LVKDRETGNSKGYAFCVYQDPSVTDIACAALNGIKMGDKTLTVRRAI 452 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,790,321 Number of Sequences: 28952 Number of extensions: 301341 Number of successful extensions: 1048 Number of sequences better than 10.0: 142 Number of HSP's better than 10.0 without gapping: 889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -