BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30259 (302 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 98 1e-21 SB_20921| Best HMM Match : WD40 (HMM E-Value=8.9) 27 3.9 SB_5591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.9 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.1 SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) 26 5.1 SB_8320| Best HMM Match : p450 (HMM E-Value=0) 26 5.1 SB_217| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.1 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 26 6.7 SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) 25 8.9 SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 25 8.9 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 25 8.9 SB_1597| Best HMM Match : PHD (HMM E-Value=1.4e-05) 25 8.9 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 97.9 bits (233), Expect = 1e-21 Identities = 48/88 (54%), Positives = 64/88 (72%), Gaps = 4/88 (4%) Frame = +3 Query: 3 DVTNSELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKVLKRPRFEISKLMELH-X 179 +V+ ++L+EVVNKLIPDSI KDIEK+C IYPL DV IRKVKVLK+P+F+I KLME+H Sbjct: 58 EVSTNDLKEVVNKLIPDSIGKDIEKSCQSIYPLHDVHIRKVKVLKKPKFDIGKLMEMHGE 117 Query: 180 XXXXXXXXXXDKSER---QEGYEPPVQE 254 D++ +EG+EPP+Q+ Sbjct: 118 ASSHATTTTTDETGTKIDREGFEPPIQD 145 >SB_20921| Best HMM Match : WD40 (HMM E-Value=8.9) Length = 101 Score = 26.6 bits (56), Expect = 3.9 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -1 Query: 251 LNGRLVALL-PFRLVSGFPLASTAFAVKFHQLRDLETGPLQHFHL-SDANI 105 +NGR VA P L+ F +K + LR + GP FH+ +D NI Sbjct: 5 VNGRPVAAFDPEGLI--FAAGIDCEMIKLYDLRSFDKGPFSTFHIQTDPNI 53 >SB_5591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1038 Score = 26.6 bits (56), Expect = 3.9 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 Query: 129 LSPFGCKHRAEGRCHGRPSRCPWQWSQESTCSP 31 L P GC R G S P + +Q STC P Sbjct: 457 LQPGGCDSRISGGRRKGSSSAPPRGAQRSTCRP 489 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 26.2 bits (55), Expect = 5.1 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +2 Query: 59 CQGHREGLP-WHLPSARCLHPKGESVEEAPFR 151 C G E L HLP +C+ K E+ PFR Sbjct: 339 CCGSEESLMLMHLPLQKCIGKKDLGSEQRPFR 370 >SB_18995| Best HMM Match : rve (HMM E-Value=0.0012) Length = 1225 Score = 26.2 bits (55), Expect = 5.1 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 171 VPSTSRSRNGASSTLSPFGC 112 VP+TSRS + AS +L+ GC Sbjct: 814 VPATSRSGDSASRSLTNLGC 833 >SB_8320| Best HMM Match : p450 (HMM E-Value=0) Length = 1207 Score = 26.2 bits (55), Expect = 5.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 81 RPSRCPWQWSQESTCSPPP 25 RP R P++W + +PPP Sbjct: 583 RPQRRPYRWKRAKPTTPPP 601 >SB_217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 26.2 bits (55), Expect = 5.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 227 LPFRLVSGFPLASTAFAVKFHQLRDLETGPLQHFHL 120 L + V G P + F V F ++ E P++H HL Sbjct: 871 LNIKKVLGAPQSPETFRVTFWLQQNFENSPIEHNHL 906 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 25.8 bits (54), Expect = 6.7 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +3 Query: 18 ELREVVNKLIPDSIAKDIEKA 80 E + V+NKL+ +SIAK + +A Sbjct: 340 EAQSVINKLVDESIAKKVTEA 360 >SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) Length = 2376 Score = 25.4 bits (53), Expect = 8.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 24 REVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKV 131 RE ++K +PD + KDI G PL + K+ Sbjct: 1014 REWIDKNLPDLVVKDITSLLEGGSPLELIAANGGKI 1049 >SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 628 Score = 25.4 bits (53), Expect = 8.9 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 9/56 (16%) Frame = -3 Query: 165 STSRSRNGASSTLSPFGCKHR----AEGRCHGRPSRCPWQ-----WSQESTCSPPP 25 S S N ++ P C + A RC RC Q WS E+ CS PP Sbjct: 132 SDEMSCNATATPFVPRSCHYWEFQCANRRCVYNSQRCDGQNDCGDWSDETGCSTPP 187 >SB_8817| Best HMM Match : I-set (HMM E-Value=0) Length = 2526 Score = 25.4 bits (53), Expect = 8.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 187 VEARGKPETSLNGRRATSL 243 + GKPE LNG R TSL Sbjct: 1808 IRVAGKPEPWLNGSRMTSL 1826 >SB_1597| Best HMM Match : PHD (HMM E-Value=1.4e-05) Length = 763 Score = 25.4 bits (53), Expect = 8.9 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +2 Query: 68 HREGL-PWHLPSARCLHPKGESVEEAP 145 HR L P+ LPS+ HP+ +E AP Sbjct: 44 HRRLLSPYKLPSSNVRHPRAVPLEAAP 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,714,385 Number of Sequences: 59808 Number of extensions: 128160 Number of successful extensions: 404 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 364677581 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -