BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30259 (302 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal p... 97 1e-22 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 27 0.21 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 1.5 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 1.9 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 22 4.4 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 22 5.9 DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 21 7.8 AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 21 7.8 AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding pr... 21 7.8 AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding pr... 21 7.8 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 21 7.8 >X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal protein homologue protein. Length = 269 Score = 97.1 bits (231), Expect = 1e-22 Identities = 49/89 (55%), Positives = 61/89 (68%), Gaps = 6/89 (6%) Frame = +3 Query: 3 DVTNSELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKVLKRPRFEISKLMELHXX 182 ++T+++L+ VV KL+PDSIAKDIEKAC +YPL DV IRKVKVLK+PRF++S LMELH Sbjct: 178 EITSTDLKGVVEKLLPDSIAKDIEKACQVVYPLHDVYIRKVKVLKKPRFDLSSLMELHGD 237 Query: 183 XXXXXXXXXDKSE------RQEGYEPPVQ 251 + R EGYEPPVQ Sbjct: 238 GGGKAAEVSTGAASGVVVVRPEGYEPPVQ 266 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 26.6 bits (56), Expect = 0.21 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 92 LPSARCLHPKGESVEEAPFRDLEVDGT 172 +P C H G ++E+A LE DGT Sbjct: 557 MPPKGCSHDDGPALEKAQLYQLESDGT 583 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -1 Query: 122 LSDANIAQRVDAMAGLLDVLGNGVRNQLV 36 L+ AN QR++ L D++G+ RN+++ Sbjct: 560 LAIANALQRINTPKYLYDIIGDYFRNRVL 588 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 147 NGASSTLSPFGCKHRAEGRCHGRPSRCPWQWSQESTCSP 31 NG + G H G RPSR ++ S C P Sbjct: 146 NGLGLEVLNIGTSHTFRGCGSARPSRIDVAFASPSICRP 184 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 221 FRLVSGFPLASTAFAVKFHQLRD 153 FR +SG P++ A+K + L+D Sbjct: 135 FRALSGLPISPYFSALKLNWLKD 157 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 113 ANIAQRVDAMAGLLDVLGNGVRNQLV 36 A QR++ L D++GN RN+++ Sbjct: 568 ARSLQRINIPKYLYDIIGNYFRNRVL 593 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 15 SELREVVNKLIPDSIAKDIEK 77 +ELR++VN + P +A+ E+ Sbjct: 257 TELRQIVNSITPAHLAQIDER 277 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 104 RCLHPKGESVEEAPF 148 RCL+P+GE++ + F Sbjct: 113 RCLYPEGETLCDKAF 127 >AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding protein AgamOBP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 104 RCLHPKGESVEEAPF 148 RCL+P+GE++ + F Sbjct: 113 RCLYPEGETLCDKAF 127 >AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding protein protein. Length = 144 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 104 RCLHPKGESVEEAPF 148 RCL+P+GE++ + F Sbjct: 113 RCLYPEGETLCDKAF 127 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 122 LSDANIAQRVDAMAGLLDVL 63 L D N A++ AGL+D + Sbjct: 269 LEDVNFAEQATTHAGLVDAM 288 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 258,470 Number of Sequences: 2352 Number of extensions: 4394 Number of successful extensions: 22 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19557855 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -