BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30259 (302 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 1.4 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 1.4 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 2.5 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 2.5 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 2.5 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 4.4 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 4.4 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 20 7.7 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 20 7.7 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 20 7.7 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 1.4 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 165 STSRSRNGASSTLSPFGCKHRAEGRCHGRPS 73 S S+S+ + S++S + + G C RPS Sbjct: 22 SNSQSQRSSGSSISRNSNRSESSGYCGRRPS 52 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.2 bits (45), Expect = 1.4 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 165 STSRSRNGASSTLSPFGCKHRAEGRCHGRPS 73 S S+S+ + S++S + + G C RPS Sbjct: 22 SNSQSQRSSGSSISRNSNRSESSGYCGRRPS 52 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.4 bits (43), Expect = 2.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 117 GCKHRAEGRC 88 GC R EGRC Sbjct: 132 GCGERTEGRC 141 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 2.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 117 GCKHRAEGRC 88 GC R EGRC Sbjct: 137 GCGERTEGRC 146 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 2.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 117 GCKHRAEGRC 88 GC R EGRC Sbjct: 137 GCGERTEGRC 146 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 20.6 bits (41), Expect = 4.4 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 95 VDAMAGLLDVLG 60 V A+AGLL VLG Sbjct: 300 VGALAGLLSVLG 311 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 20.6 bits (41), Expect = 4.4 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -3 Query: 132 TLSPFGCKHR-AEGRCHGR-PSRCPWQWSQEST 40 T+ P GC A+ R P R P+QW ++ Sbjct: 401 TVDPAGCNAGPAKYYLKSRDPERTPYQWDNSTS 433 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 19.8 bits (39), Expect = 7.7 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = +2 Query: 83 PWHLPSARCLH 115 P+H P C+H Sbjct: 328 PYHTPEPDCIH 338 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 19.8 bits (39), Expect = 7.7 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 49 LTPLPRTSRRPAMASTLCAM 108 L LP RPA ++ CA+ Sbjct: 149 LNLLPMNRNRPAYLASKCAL 168 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 19.8 bits (39), Expect = 7.7 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 95 VDAMAGLLDVLGNGVRNQLVHHL 27 +D + ++VLG+G +V+HL Sbjct: 473 LDRIRTSINVLGDGYGAGIVYHL 495 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,782 Number of Sequences: 438 Number of extensions: 1104 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6368931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -