BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30259 (302 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34670.1 68417.m04922 40S ribosomal protein S3A (RPS3aB) 75 9e-15 At3g04840.1 68416.m00525 40S ribosomal protein S3A (RPS3aA) simi... 73 5e-14 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 27 1.8 At5g38550.1 68418.m04661 jacalin lectin family protein similar t... 27 2.4 At5g44290.1 68418.m05421 protein kinase family protein contains ... 27 3.2 At1g78700.1 68414.m09173 brassinosteroid signalling positive reg... 27 3.2 At1g54570.1 68414.m06223 esterase/lipase/thioesterase family pro... 27 3.2 At5g28080.1 68418.m03391 protein kinase family protein contains ... 26 4.2 At5g56930.1 68418.m07107 zinc finger (CCCH-type) family protein ... 25 7.4 At4g10300.1 68417.m01694 expressed protein 25 7.4 At1g01780.1 68414.m00097 LIM domain-containing protein similar t... 25 7.4 At5g66100.1 68418.m08327 La domain-containing protein similar to... 25 9.7 >At4g34670.1 68417.m04922 40S ribosomal protein S3A (RPS3aB) Length = 262 Score = 74.9 bits (176), Expect = 9e-15 Identities = 31/58 (53%), Positives = 48/58 (82%) Frame = +3 Query: 3 DVTNSELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKVLKRPRFEISKLMELH 176 + ++ +L+E+V K IP++I ++IEKA GIYPL++V IRKVK+LK P+F++ KLME+H Sbjct: 175 EASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEVH 232 >At3g04840.1 68416.m00525 40S ribosomal protein S3A (RPS3aA) similar to 40S ribosomal protein S3A (S phase specific protein GBIS289) GB:P49396 [Brassica rapa] Length = 262 Score = 72.5 bits (170), Expect = 5e-14 Identities = 29/58 (50%), Positives = 48/58 (82%) Frame = +3 Query: 3 DVTNSELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKVLKRPRFEISKLMELH 176 + ++ +L+++V K IP++I ++IEKA GIYPL++V IRKVK+LK P+F++ KLM++H Sbjct: 175 EASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMDVH 232 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.5 bits (58), Expect = 1.8 Identities = 19/62 (30%), Positives = 24/62 (38%) Frame = -3 Query: 258 TPLEREARSPPAVQTXXXXXXXXXXXXREVPSTSRSRNGASSTLSPFGCKHRAEGRCHGR 79 TP+ R +R + PS SRS + SP G KH+ E R GR Sbjct: 587 TPVNRRSRRSSSASRSPDRRRRRSPSSSRSPSRSRSPPVLHRSPSPRGRKHQRERRSPGR 646 Query: 78 PS 73 S Sbjct: 647 LS 648 >At5g38550.1 68418.m04661 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 594 Score = 27.1 bits (57), Expect = 2.4 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 Query: 53 LHCQGHREGLPW 88 L CQG R+GLPW Sbjct: 299 LECQGDRKGLPW 310 >At5g44290.1 68418.m05421 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 644 Score = 26.6 bits (56), Expect = 3.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 90 IYPLRDVCIRKVKVLKRPRFEISKL 164 +Y RD+ K+ LKR RF++S L Sbjct: 151 VYKARDLTNNKIVALKRVRFDLSDL 175 >At1g78700.1 68414.m09173 brassinosteroid signalling positive regulator-related contains similarity to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 325 Score = 26.6 bits (56), Expect = 3.2 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -3 Query: 126 SPFGCKHRAEGRCHGRPSRCPWQWSQESTCSP--PP 25 +PFG K A G W Q TCSP PP Sbjct: 234 NPFGFKEEAASAAGGGGGSRMWTPGQSGTCSPAIPP 269 >At1g54570.1 68414.m06223 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 Length = 704 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -1 Query: 212 VSGFPLASTAFAVKFHQLRDLETGPLQHFHLSDANIAQR 96 ++G P V +H L LE GP+ + + NI R Sbjct: 438 LAGVPDKGPVLLVGYHMLMGLELGPMSEAFIKEKNILFR 476 >At5g28080.1 68418.m03391 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 406 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -1 Query: 131 HFHLSDANIAQRVDAMAGLLDVLGNGVRNQLVHHLPEF 18 HF D + +RV++ GL+D G +R+ +H+P + Sbjct: 194 HFLCIDESDMRRVESEKGLIDEAGTPLRHS--YHIPHY 229 >At5g56930.1 68418.m07107 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 675 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -3 Query: 114 CKHRAEGRCH-GRPSRCPWQWSQESTCSP 31 C+H +GRCH G + E+ CSP Sbjct: 356 CRHYLKGRCHEGDKCKFSHDTIPETKCSP 384 >At4g10300.1 68417.m01694 expressed protein Length = 134 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -3 Query: 150 RNGASSTLSPFGCKHRAEGRCHGRPSRCPWQWSQESTC 37 +N S L+ G + + C PS+ PW +S + TC Sbjct: 50 KNPPESKLTQLGVRSWPKWGCP--PSKFPWTYSAKETC 85 >At1g01780.1 68414.m00097 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 205 Score = 25.4 bits (53), Expect = 7.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 74 EGLPWHLPSARCLHPKG 124 EG+P+H RC H KG Sbjct: 26 EGMPYHKSCFRCTHCKG 42 >At5g66100.1 68418.m08327 La domain-containing protein similar to SP|P40796 La protein homolog (La ribonucleoprotein) (La autoantigen homolog) {Drosophila melanogaster}; contains Pfam profile PF05383: La domain Length = 453 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +2 Query: 41 VDS*LHCQGHREGLPWHLPSARCLHPKGESVEEAPF 148 +DS + H + PW LPS HP ++ PF Sbjct: 18 IDSSISRSRHGDSSPWLLPSDSHDHPTLSLSQDDPF 53 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,400,683 Number of Sequences: 28952 Number of extensions: 87753 Number of successful extensions: 296 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 296 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 301317600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -