BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30257 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 113 2e-25 SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) 32 0.53 SB_17046| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_40531| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 28 8.7 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 113 bits (271), Expect = 2e-25 Identities = 51/70 (72%), Positives = 62/70 (88%) Frame = +1 Query: 508 RKKMCEIITRDVTNSELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKVLKRPRFE 687 RKKM +IITR+V+ ++L+EVVNKLIPDSI KDIEK+C IYPL DV IRKVKVLK+P+F+ Sbjct: 48 RKKMVDIITREVSTNDLKEVVNKLIPDSIGKDIEKSCQSIYPLHDVHIRKVKVLKKPKFD 107 Query: 688 ISKLMELHGE 717 I KLME+HGE Sbjct: 108 IGKLMEMHGE 117 Score = 73.7 bits (173), Expect = 1e-13 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +2 Query: 371 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRAIERKCV 523 TLIEA +DVKTTDGY+LR+FCIGFT + +KT YA+HTQ++AI +K V Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMV 52 >SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) Length = 882 Score = 31.9 bits (69), Expect = 0.53 Identities = 20/74 (27%), Positives = 36/74 (48%) Frame = +1 Query: 460 EPTQDVLRPAHSGQSNRKKMCEIITRDVTNSELREVVNKLIPDSIAKDIEKACHGIYPLR 639 EPT D RP+H ++ +I R + ELR+ + + P + D + + P+ Sbjct: 276 EPTPDPSRPSHRPGADNLTRDDI--RQIIQQELRKELRRSNPPNQNYDRNRRTYTGIPIS 333 Query: 640 DVCIRKVKVLKRPR 681 IR+ ++ +RPR Sbjct: 334 SKYIREGRIEERPR 347 >SB_17046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 29.9 bits (64), Expect = 2.2 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 2/94 (2%) Frame = -1 Query: 561 PEFRVSDVACNDFTH--FLSIALT*VCWA*HVLRWLKESLLVKPMQKTRRTYPSVVFTSM 388 P R D C FTH + I++ + ++ + LVKPMQ RR V+ ++ Sbjct: 85 PTGRSGDWICKFFTHNAIMQISVLTSIFTLTIVSVERYHALVKPMQVGRRLTEDTVWYAV 144 Query: 387 LASMRVCHFLTIHLSLSVVRSMPWKLQSTLRPCT 286 +AS T L L+V + K T + CT Sbjct: 145 IASW------TASLILTVPSFVAIKFDETRKACT 172 >SB_40531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 28.3 bits (60), Expect = 6.6 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -2 Query: 158 VDKRGADLPLAEHRRSLDIVPIFASEWVDNLLLNTFFTALRQAFIFPDR 12 VD + + +++ D+ PIF + V LLL T FT L+ + DR Sbjct: 159 VDNQFVPFQTLQTKKAFDVEPIFNGKDVFLLLLWTLFTYLQVISVLNDR 207 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 484 PAHSGQSNRKKMCEIITRDVTNSELREVVNKLIPDSI 594 P + N+KKM + ++V NS L VNK I SI Sbjct: 683 PGNLSTLNKKKMVRLFWQEVKNSPLINGVNKTIWGSI 719 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,371,103 Number of Sequences: 59808 Number of extensions: 515107 Number of successful extensions: 1496 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1495 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -