BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30257 (717 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal p... 146 6e-37 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 27 0.58 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 5.4 AY146739-1|AAO12099.1| 176|Anopheles gambiae odorant-binding pr... 23 7.2 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 7.2 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 7.2 >X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal protein homologue protein. Length = 269 Score = 146 bits (354), Expect = 6e-37 Identities = 65/89 (73%), Positives = 78/89 (87%) Frame = +2 Query: 251 KAFRKFRLIAEYVQGRNVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVF 430 ++FRKF+L+AE V GR+VL NFHGM LTTDKLR MV KWQTLIE ++DVKTTDG++LRVF Sbjct: 82 RSFRKFKLVAESVNGRDVLTNFHGMALTTDKLRSMVNKWQTLIECSVDVKTTDGFMLRVF 141 Query: 431 CIGFTNKDSLSQRKTCYAQHTQVRAIERK 517 CIGFT KDS+SQRKTCYAQH+Q++ I K Sbjct: 142 CIGFTIKDSMSQRKTCYAQHSQIKNIRAK 170 Score = 111 bits (267), Expect = 2e-26 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = +3 Query: 69 IVDPFTRKDWYDVKAPSVFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLADLQADTDA 248 +VDPFTRKDWYDVKAP++F RQ G TLVNRTQGTKIAS+GLKGRVFEVSLADLQ + DA Sbjct: 21 VVDPFTRKDWYDVKAPNMFKNRQSGKTLVNRTQGTKIASDGLKGRVFEVSLADLQNEPDA 80 Query: 249 ER 254 ER Sbjct: 81 ER 82 Score = 104 bits (250), Expect = 2e-24 Identities = 50/77 (64%), Positives = 62/77 (80%), Gaps = 1/77 (1%) Frame = +1 Query: 490 HSGQSN-RKKMCEIITRDVTNSELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKV 666 HS N R KM II R++T+++L+ VV KL+PDSIAKDIEKAC +YPL DV IRKVKV Sbjct: 161 HSQIKNIRAKMTAIIKREITSTDLKGVVEKLLPDSIAKDIEKACQVVYPLHDVYIRKVKV 220 Query: 667 LKRPRFEISKLMELHGE 717 LK+PRF++S LMELHG+ Sbjct: 221 LKKPRFDLSSLMELHGD 237 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 27.1 bits (57), Expect = 0.58 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 627 LPSARCLHPKGESVEEAPFRDLEVDGTS 710 +P C H G ++E+A LE DGT+ Sbjct: 557 MPPKGCSHDDGPALEKAQLYQLESDGTA 584 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -1 Query: 657 LSDANIAQRVDAMAGLLDVLGNGVRNQLV 571 L+ AN QR++ L D++G+ RN+++ Sbjct: 560 LAIANALQRINTPKYLYDIIGDYFRNRVL 588 >AY146739-1|AAO12099.1| 176|Anopheles gambiae odorant-binding protein AgamOBP29 protein. Length = 176 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 496 GQSNRKKMCEIITRDVTNSELRE 564 G + K+ +IT+D+ ELRE Sbjct: 102 GFPEKHKVLHVITKDIREHELRE 124 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.4 bits (48), Expect = 7.2 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 9/85 (10%) Frame = -3 Query: 415 VSIGCLHINVGFD-------ESLPFFNHPPELIGCEVHAVEVAEH--ITSLHIFGD*SEF 263 +S+ L + GFD +++ F + P + ++ H ++SLH G Sbjct: 811 LSVAILRVGKGFDYSQVLGEDTVKFISEYPRTLVANDSTNDLLSHNKVSSLH--GS---- 864 Query: 262 AESLSASVSACRSARETSKTLPFNP 188 +SLS +VS S + SKT+ P Sbjct: 865 CDSLSRNVSQASSTSDLSKTISVAP 889 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 682 NGASSTLSPFGCKHRAEGRCHGRPSRCPWQWSQESTCSP 566 NG + G H G RPSR ++ S C P Sbjct: 146 NGLGLEVLNIGTSHTFRGCGSARPSRIDVAFASPSICRP 184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 778,611 Number of Sequences: 2352 Number of extensions: 16696 Number of successful extensions: 47 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -