BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30254 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2... 95 7e-21 SPAC2F3.15 |lsk1||latrunculin sensitive kinase Lsk1 |Schizosacch... 30 0.37 SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pom... 27 2.6 SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces ... 27 3.5 SPAC13G6.08 |||Cdc20/Fizzy family WD repeat protein|Schizosaccha... 25 8.0 SPBC25B2.06c |btb2||BTB/POZ domain protein Btb2|Schizosaccharomy... 25 8.0 >SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 95.5 bits (227), Expect = 7e-21 Identities = 44/84 (52%), Positives = 57/84 (67%), Gaps = 1/84 (1%) Frame = +3 Query: 6 SPNKMSIT-AQSGRAWTENPDHPHYQAAARATKLIYQTDPDMSREGGSIPVTITLQEASG 182 S NK++ SG W +PDH HY +AT+ +Y PD REGGSIPVT+T +++ Sbjct: 369 SKNKLAFNNMHSGSWWISSPDHWHYDVGKKATERVYGITPDFVREGGSIPVTVTFEQSLK 428 Query: 183 KNVLLLPMGAGDDMAHSQNEKINV 254 KNVLLLPMG GDD AHS NEK+++ Sbjct: 429 KNVLLLPMGRGDDGAHSINEKLDL 452 >SPAC2F3.15 |lsk1||latrunculin sensitive kinase Lsk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 593 Score = 29.9 bits (64), Expect = 0.37 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -3 Query: 457 GSLFISIYPSPGYERFHKI--KSFGKITKTIKTIS 359 G ++ YP P YE+ +I ++GK+ K I T++ Sbjct: 265 GPIYTYTYPKPAYEKIDQIGEGTYGKVYKAINTVT 299 >SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 27.1 bits (57), Expect = 2.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 505 HDLTVLFPKRGYKIDCGS 452 HDL LF KR ++ DCG+ Sbjct: 74 HDLVDLFNKRHFRCDCGT 91 >SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 301 Score = 26.6 bits (56), Expect = 3.5 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 418 ERFHKIKSFGKITKTIKTIS 359 +R IK+ KITKTIKT++ Sbjct: 39 QRLKSIKNIEKITKTIKTVA 58 >SPAC13G6.08 |||Cdc20/Fizzy family WD repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 535 Score = 25.4 bits (53), Expect = 8.0 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 6/107 (5%) Frame = -3 Query: 619 KTNELRKKVNIFLQNSVPDYFLNC*QSYTLPPKIDLPPHDLTVLFPK--RGYKID---CG 455 K ++LR+ + ++ QN+ C +L HD + F G KID CG Sbjct: 350 KGSDLRQPLYVWQQNAAVKALSFCPWQRSLLAT-GAGSHDKHIRFYNCFNGKKIDELYCG 408 Query: 454 SLFISIYPSPGYERFHKIKSFGKITKTIKTISYSFYV*H-PRRPCLL 317 + SI+ SP Y F +FG +++T+ + F V P+ CL+ Sbjct: 409 AQITSIHWSPKYREFS--VTFG---YSLETVQHRFAVYSWPQLECLV 450 >SPBC25B2.06c |btb2||BTB/POZ domain protein Btb2|Schizosaccharomyces pombe|chr 2|||Manual Length = 284 Score = 25.4 bits (53), Expect = 8.0 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -2 Query: 608 IEKKGQYFFTEFSSGLFSKLLTILYFT-AKNRSTS-TRLNC 492 +E+ + F+SGLF+K + ++Y T N +T RL C Sbjct: 158 LERLKMGMYPRFTSGLFNKAIQVMYNTLVSNWNTEYARLLC 198 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,718,162 Number of Sequences: 5004 Number of extensions: 55834 Number of successful extensions: 153 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -