BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30254 (708 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0455 - 3614011-3614503,3615007-3615072,3615154-3615347,361... 29 4.8 12_01_0906 + 8799284-8799441,8800865-8801690,8801933-8802055,880... 28 6.3 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 28 6.3 05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237,364... 28 6.3 07_03_0218 + 15305474-15306082,15306127-15306327,15306442-15306552 28 8.4 01_06_0054 - 26027072-26028463 28 8.4 >05_01_0455 - 3614011-3614503,3615007-3615072,3615154-3615347, 3615562-3615657,3615790-3615829,3616729-3616856 Length = 338 Score = 28.7 bits (61), Expect = 4.8 Identities = 21/61 (34%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Frame = +2 Query: 5 VPEQDEHHGTER---PRL--DREPGPSALPGRRTRH*ADISDRSGHVPRRRFDPRHDHSA 169 +P + + GT R P DR PG +ALP H SD PR R D H Sbjct: 224 LPSNERYDGTRRYASPSYGRDRSPGGNALPANGRSHNL-TSDGMNPSPRERDDQNGSHRR 282 Query: 170 G 172 G Sbjct: 283 G 283 >12_01_0906 + 8799284-8799441,8800865-8801690,8801933-8802055, 8802144-8802210,8802611-8802714,8802798-8802900, 8803103-8803401,8804009-8804263,8805471-8805776, 8805866-8806194,8806829-8806916,8807027-8807164, 8807438-8807458 Length = 938 Score = 28.3 bits (60), Expect = 6.3 Identities = 22/62 (35%), Positives = 26/62 (41%), Gaps = 4/62 (6%) Frame = +2 Query: 2 RVPEQDEHHGTERPRLDREPGPSALPGRRTRH*A-DISDRSGHVPRRRF---DPRHDHSA 169 RVP+ +E G R R R GRR R + D D G RRR P + S Sbjct: 90 RVPDAEEEGGDRRRRPSRVSDDDKEGGRRRRRRSTDSDDERGDRHRRRHRRRSPSSESSD 149 Query: 170 GG 175 GG Sbjct: 150 GG 151 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 596 LFSQFVGLGHITKDIEICNFNVEDMKYIPFIKYNLKL 706 L +F+G ++ D NFN +K+ P +KYN+KL Sbjct: 2278 LSDRFLGF-YMVPDNTPWNFNFMGVKHDPLMKYNMKL 2313 >05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237, 3645328-3645525,3645614-3646249,3646352-3646606, 3646718-3646824,3646909-3650705,3650816-3651305, 3652043-3652433,3652621-3652713,3652818-3652941, 3653871-3654118 Length = 2350 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 596 LFSQFVGLGHITKDIEICNFNVEDMKYIPFIKYNLKL 706 L +F+G ++ D NFN +K+ P +KYN+KL Sbjct: 2278 LSDRFLGF-YMVPDNTPWNFNFMGVKHDPLMKYNMKL 2313 >07_03_0218 + 15305474-15306082,15306127-15306327,15306442-15306552 Length = 306 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = -3 Query: 250 LIFSFCECAMSSPAPMGNSNTFLPLASCRVIVTGIEPPSRDMSGSV*YISLVARAAAW 77 L+F+F + + +P P+G + + LA+ + TGI P+R + +V Y + A + W Sbjct: 215 LLFNFDKSKVLAPLPIGFAVFMVHLATIPITGTGIN-PARSLGVAVVYNNNKAWSDQW 271 >01_06_0054 - 26027072-26028463 Length = 463 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/58 (32%), Positives = 26/58 (44%) Frame = -3 Query: 250 LIFSFCECAMSSPAPMGNSNTFLPLASCRVIVTGIEPPSRDMSGSV*YISLVARAAAW 77 L+FS E AM+S +F+ L V +TG +SG V Y+ L R W Sbjct: 378 LLFSGIELAMASRDMGSKQESFVMLVCAGVSLTGSSAALGFISGIVLYLLLRLRDLEW 435 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,119,787 Number of Sequences: 37544 Number of extensions: 389433 Number of successful extensions: 895 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -