BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30254 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5477| Best HMM Match : M20_dimer (HMM E-Value=0.096) 115 3e-26 SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_27599| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_23338| Best HMM Match : Homeobox (HMM E-Value=3.1e-26) 28 6.5 SB_49271| Best HMM Match : DUF916 (HMM E-Value=4.4) 28 6.5 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 28 8.5 >SB_5477| Best HMM Match : M20_dimer (HMM E-Value=0.096) Length = 543 Score = 115 bits (277), Expect = 3e-26 Identities = 51/84 (60%), Positives = 65/84 (77%), Gaps = 1/84 (1%) Frame = +3 Query: 3 GSPNKMSITA-QSGRAWTENPDHPHYQAAARATKLIYQTDPDMSREGGSIPVTITLQEAS 179 GSPN + ++ G+ W + DHPHYQA A K ++ DPD++REGGSIPVT++LQEA+ Sbjct: 98 GSPNPVKVSCGHGGKPWMSDFDHPHYQAGRNAMKTVFGVDPDLTREGGSIPVTLSLQEAT 157 Query: 180 GKNVLLLPMGAGDDMAHSQNEKIN 251 GKNV+LLP+GA DD AHSQNEKIN Sbjct: 158 GKNVMLLPVGACDDGAHSQNEKIN 181 >SB_52975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 32.7 bits (71), Expect = 0.30 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = -3 Query: 208 PMGNSNTFLPLASCRVIVTGIEPPSRDMSGSV*YISLVARAAAW*CGWSGFSVQARPLC 32 P + T L SC + + PP R + G++ ISL AA C S V RP+C Sbjct: 935 PASDGKTRRKLGSCGALAQPVGPPPRGLLGALWCISLQQAVAA--CSGSAEVVFLRPVC 991 >SB_27599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2937 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 214 PAPMGNSNTFLPLASCRVIVTGIEPPSRDM 125 P G+SNT+ P C + PP D+ Sbjct: 604 PTGCGSSNTWTPCTDCETTYGSVRPPGNDL 633 >SB_23338| Best HMM Match : Homeobox (HMM E-Value=3.1e-26) Length = 275 Score = 28.3 bits (60), Expect = 6.5 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 4/77 (5%) Frame = +3 Query: 12 NKMSITAQSG-RAWTENPDHPHYQAAARATKLIYQTD-PDMSREGGSIPVTITLQEAS-- 179 N +S Q G + +P +P YQAA+ T L Y + P + R +P T + ++ Sbjct: 171 NSISRDLQPGIHGYQPHPVYPRYQAASPLTYLGYSPELPQLHRP--PLPPTYFEKPSAEF 228 Query: 180 GKNVLLLPMGAGDDMAH 230 ++ L MG G D+AH Sbjct: 229 PQSPNLYRMGPGPDVAH 245 >SB_49271| Best HMM Match : DUF916 (HMM E-Value=4.4) Length = 491 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 576 FCKKILTFFLNSLVLGILQRISR 644 FC L FF+N++++GI +SR Sbjct: 30 FCVMSLVFFMNNVIVGIASAVSR 52 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 532 LPPKIDLPPHDLTVLFPKRGYKIDCGSL 449 +PPK++LP TV + +GY I S+ Sbjct: 861 VPPKVELPSSFTTVWYSNQGYHIIASSI 888 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,491,578 Number of Sequences: 59808 Number of extensions: 414837 Number of successful extensions: 974 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 974 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -