BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30254 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 6.6 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 21 8.7 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 8.7 AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor p... 21 8.7 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 6.6 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +3 Query: 15 KMSITAQSG-RAWTENPDHPHYQAAARATKLIYQTDPDMSREGGSIPV 155 K+ + SG + TE PD P +A+ A + + +E +PV Sbjct: 573 KLDSPSDSGIESGTEKPDKPASSSASSAPTSVCSSPRSEDKEVEDMPV 620 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 21.4 bits (43), Expect = 8.7 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = +2 Query: 41 PRLDREPGPSALPGRRTRH*ADISDRSGHVPRRRFDPRHDHSAGGER 181 PRL RE P A PG R R H PR R + + + G R Sbjct: 225 PRLRREAEPEAEPG-NNRPVYIPQPRPPH-PRLRREAKPEAKPGNNR 269 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/33 (24%), Positives = 17/33 (51%) Frame = -3 Query: 217 SPAPMGNSNTFLPLASCRVIVTGIEPPSRDMSG 119 +P P G+ +T + ASC++ ++ + G Sbjct: 125 TPTPNGHPSTPIVYASCKLQAAAVDHQGSVLDG 157 >AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor protein. Length = 199 Score = 21.4 bits (43), Expect = 8.7 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = +2 Query: 41 PRLDREPGPSALPGRRTRH*ADISDRSGHVPRRRFDPRHDHSAGGER 181 PRL RE P A PG R R H PR R + + + G R Sbjct: 113 PRLRREAEPEAEPG-NNRPVYIPQPRPPH-PRLRREAKPEAEPGNNR 157 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,047 Number of Sequences: 438 Number of extensions: 3832 Number of successful extensions: 28 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -