BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30254 (708 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA... 28 5.3 At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA... 28 5.3 At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA... 28 5.3 At3g18770.1 68416.m02382 expressed protein 28 7.0 At2g17790.1 68415.m02062 vacuolar protein sorting-associated pro... 28 7.0 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 27 9.2 >At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 362 NCLYSFSNLTETLYFMKTLVAWRR 433 N YS + +E + F+K+LV W+R Sbjct: 359 NAFYSLRDPSEVMEFLKSLVTWKR 382 >At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 384 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 362 NCLYSFSNLTETLYFMKTLVAWRR 433 N YS + +E + F+K+LV W+R Sbjct: 358 NAFYSLRDPSEVMEFLKSLVTWKR 381 >At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 362 NCLYSFSNLTETLYFMKTLVAWRR 433 N YS + +E + F+K+LV W+R Sbjct: 359 NAFYSLRDPSEVMEFLKSLVTWKR 382 >At3g18770.1 68416.m02382 expressed protein Length = 625 Score = 27.9 bits (59), Expect = 7.0 Identities = 22/74 (29%), Positives = 36/74 (48%) Frame = -3 Query: 454 SLFISIYPSPGYERFHKIKSFGKITKTIKTISYSFYV*HPRRPCLLGEFTDLEQVGGKQF 275 SLF+ + P Y+ F ++ S G+I K K + PR P ++ FT E+ ++F Sbjct: 189 SLFVMVRLLPAYKIFRELNSSGQIFK-FKLV--------PRVPSIVEPFTRKEEAEMQKF 239 Query: 274 YAFDVVATLIFSFC 233 +F V T+ C Sbjct: 240 -SFTPVETICGRLC 252 >At2g17790.1 68415.m02062 vacuolar protein sorting-associated protein 35 family protein / VPS35 family protein similar to vacuolar protein sorting 35 [Mus musculus] GI:11875394; contains Pfam profile PF03635: Vacuolar protein sorting-associated protein 35 Length = 830 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 330 RRGCYT*KLYEIVFIVLVILPKLFIL 407 RRGC +LYE+V ILP+L++L Sbjct: 83 RRGCSVIELYELVQHAGNILPRLYLL 108 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 199 NSNTFLPLASCRVIVTGIEPPS 134 N N F+PLA +I GI PPS Sbjct: 268 NLNIFIPLALQALITCGINPPS 289 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,291,757 Number of Sequences: 28952 Number of extensions: 300180 Number of successful extensions: 733 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -