BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30252X (413 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2FAB5 Cluster: Rh183; n=2; Cercopithecine herpesvirus ... 31 9.3 UniRef50_A5ULZ9 Cluster: Putative uncharacterized protein; n=1; ... 31 9.3 >UniRef50_Q2FAB5 Cluster: Rh183; n=2; Cercopithecine herpesvirus 8|Rep: Rh183 - Cercopithecine herpesvirus 8 (Rhesus cytomegalovirus) Length = 120 Score = 31.1 bits (67), Expect = 9.3 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +3 Query: 18 CYSCFDSATDTQTSCQLRITD---V*RHSLMYPKNTDRI 125 C C+D A+D CQ R D V R+SL PK+T I Sbjct: 30 CDECYDCASDGNVKCQSRKQDPVIVARYSLGIPKDTGMI 68 >UniRef50_A5ULZ9 Cluster: Putative uncharacterized protein; n=1; Methanobrevibacter smithii ATCC 35061|Rep: Putative uncharacterized protein - Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) Length = 171 Score = 31.1 bits (67), Expect = 9.3 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = -2 Query: 283 IKKRYLPNNIRQTLHCHLY*NFINLTAK 200 + K+YL NN++ ++H +Y NF+ TA+ Sbjct: 85 LAKKYLNNNVKNSIHIKVYSNFLKDTAE 112 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 315,151,103 Number of Sequences: 1657284 Number of extensions: 5088587 Number of successful extensions: 7669 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7669 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 19042509735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -