BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30252X (413 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G8.04c |arc15|arc5, arc5|ARP2/3 actin-organizing complex s... 28 0.50 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 25 6.1 >SPAC17G8.04c |arc15|arc5, arc5|ARP2/3 actin-organizing complex subunit Arc15|Schizosaccharomyces pombe|chr 1|||Manual Length = 152 Score = 28.3 bits (60), Expect = 0.50 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 139 EIKTIIRSVFLGYIN-E*RHTSVILNWHDVCVSVA 38 EI I+ ++ G N + ++SV+LNWH+ V ++ Sbjct: 103 EIDNIVNFIYRGLANPQAYNSSVLLNWHEKVVEIS 137 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 24.6 bits (51), Expect = 6.1 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 295 ICRLFVLVTLLATNNRFTFIHHFTETVYTTWI*FLL 402 IC F+ + L+ +N +F+ F+ + W+ FLL Sbjct: 955 ICEEFIDL-LIKSNGEPSFLRRFSSMITPAWLLFLL 989 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,396,844 Number of Sequences: 5004 Number of extensions: 23390 Number of successful extensions: 41 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 144287194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -