SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV30252X
         (413 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-2244|AAM68513.1|  146|Drosophila melanogaster CG30100-P...    27   7.4  

>AE013599-2244|AAM68513.1|  146|Drosophila melanogaster CG30100-PA
           protein.
          Length = 146

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 15/48 (31%), Positives = 26/48 (54%)
 Frame = -2

Query: 310 QIIDK*NHCIKKRYLPNNIRQTLHCHLY*NFINLTAKHRKLSNNQTDI 167
           Q ++K ++C+  R+LP NI  T+ CH +        + RKL   + D+
Sbjct: 48  QAVNKTSNCVFLRHLPTNI--TVKCHTHRLASKNRVEARKLLLEKLDV 93


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,947,940
Number of Sequences: 53049
Number of extensions: 222737
Number of successful extensions: 312
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 312
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 312
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1230182214
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -