BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30252X (413 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41264-4|AAA82424.1| 220|Caenorhabditis elegans Hypothetical pr... 27 4.1 Z83239-8|CAH60787.1| 311|Caenorhabditis elegans Hypothetical pr... 26 9.4 Z81128-1|CAB03398.1| 568|Caenorhabditis elegans Hypothetical pr... 26 9.4 AF013953-1|AAC47750.1| 568|Caenorhabditis elegans mom-5 protein. 26 9.4 >U41264-4|AAA82424.1| 220|Caenorhabditis elegans Hypothetical protein F10E7.5 protein. Length = 220 Score = 27.5 bits (58), Expect = 4.1 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +2 Query: 41 DRYTN--VVPIKNY*RMTSFIDVSQKH*SNNRFNFAKDS 151 D+Y N + I N R T FI + QK+ N+RF F K++ Sbjct: 35 DQYKNLFIFTIANM-RSTRFIAIRQKYKENSRFFFGKNN 72 >Z83239-8|CAH60787.1| 311|Caenorhabditis elegans Hypothetical protein T09F5.16 protein. Length = 311 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 276 FLMQ*FYLSIICSSNLARHQ*SFHLHSP 359 FL Y+ I+ S ARH SF LH P Sbjct: 181 FLCALLYIPILISIRKARHLSSFKLHRP 208 >Z81128-1|CAB03398.1| 568|Caenorhabditis elegans Hypothetical protein T23D8.1 protein. Length = 568 Score = 26.2 bits (55), Expect = 9.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 292 FICRLFVLVTLLATNNRFTF 351 F+C LF LVT L +RF + Sbjct: 239 FVCSLFTLVTFLVDLSRFAY 258 >AF013953-1|AAC47750.1| 568|Caenorhabditis elegans mom-5 protein. Length = 568 Score = 26.2 bits (55), Expect = 9.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 292 FICRLFVLVTLLATNNRFTF 351 F+C LF LVT L +RF + Sbjct: 239 FVCSLFTLVTFLVDLSRFAY 258 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,502,601 Number of Sequences: 27780 Number of extensions: 126193 Number of successful extensions: 218 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 673122114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -