BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30252X (413 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 25 0.26 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 2.4 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 22 3.2 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 22 3.2 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 22 3.2 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 25.4 bits (53), Expect = 0.26 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 214 NLTAKHRKLSNNQTDI*I*LGRIFCEIKTIIR 119 N+T SN T I GR FCE++ I R Sbjct: 113 NITLNIESTSNKMTVILTPPGRFFCEVRPIKR 144 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.2 bits (45), Expect = 2.4 Identities = 8/17 (47%), Positives = 13/17 (76%), Gaps = 1/17 (5%) Frame = -2 Query: 88 RHTSVILNWHD-VCVSV 41 RHTSV++ W +C+S+ Sbjct: 391 RHTSVLIGWSAFLCISL 407 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -2 Query: 88 RHTSVILNWHDVCVSVAESKQL*HDVT 8 +HT HD+C V + + H +T Sbjct: 53 KHTDACCRTHDMCPDVMSAGESKHGLT 79 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -2 Query: 88 RHTSVILNWHDVCVSVAESKQL*HDVT 8 +HT HD+C V + + H +T Sbjct: 58 KHTDACCRTHDMCPDVMSAGESKHGLT 84 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.8 bits (44), Expect = 3.2 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -2 Query: 88 RHTSVILNWHDVCVSVAESKQL*HDVT 8 +HT HD+C V + + H +T Sbjct: 58 KHTDACCRTHDMCPDVMSAGESKHGLT 84 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,795 Number of Sequences: 438 Number of extensions: 1474 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10503195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -