BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30251 (483 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 2e-28 SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) 32 0.22 SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_51828| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.5 SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) 27 8.1 >SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 122 bits (293), Expect = 2e-28 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 16/100 (16%) Frame = +3 Query: 3 QTEKAFQKQATVFLNRKGGM----KRKDMRHHKNVGLGFKTP------------REAIEG 134 QTE+A+QKQA +F NRK + K+KD+R +NVGLGFKTP REAIEG Sbjct: 4 QTERAYQKQAPIFQNRKRVLGQVTKKKDLRFVRNVGLGFKTPKDVCNCTYLLPEREAIEG 63 Query: 135 TYIDKKCPFTGNVSXRGRILTGVVQKMKMQRTIVIRRDYL 254 TYIDKKCPFTGNVS RGRILTG+ + MKM+RTI+IRRDYL Sbjct: 64 TYIDKKCPFTGNVSIRGRILTGICRSMKMKRTIIIRRDYL 103 Score = 87.0 bits (206), Expect = 7e-18 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = +2 Query: 272 NRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNNLKVS 412 NRFEKRH+N++ H SPCFRD+ +GD++T+G+CRPLSKTVRFN LKVS Sbjct: 110 NRFEKRHKNLAAHCSPCFRDIALGDLITVGQCRPLSKTVRFNVLKVS 156 >SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) Length = 73 Score = 32.3 bits (70), Expect = 0.22 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +2 Query: 341 GDIVTIGECRPLSKTVRFN 397 GD+V I ECRPLSK +FN Sbjct: 29 GDVVRIKECRPLSKMKKFN 47 >SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 144 QCRYPQSPLWEF*SLNQHSYGDACP 70 +C QS LWE SL QH Y + P Sbjct: 505 KCNALQSSLWELKSLQQHYYPEVSP 529 >SB_51828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 28.3 bits (60), Expect = 3.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 334 HVPEARRQMHGHIPVPFLEP 275 HV +A R HG++P+P L P Sbjct: 82 HVDQACRSFHGNLPLPVLAP 101 >SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) Length = 378 Score = 27.1 bits (57), Expect = 8.1 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +3 Query: 12 KAFQKQATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKK-CPFTGNVSXRGR 188 +A + T ++RK K+K+ + KN+ K PR T++ + G V+ R R Sbjct: 216 QALAMKVTSRVSRKIDSKKKNKQRRKNLRALRKAPRRPAPVTHLSARGADVDGAVALRAR 275 Query: 189 ILTGVVQK 212 G Q+ Sbjct: 276 ARAGNAQR 283 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,677,565 Number of Sequences: 59808 Number of extensions: 252023 Number of successful extensions: 531 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1013948003 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -