BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30251 (483 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 109 6e-26 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 5.5 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 23 7.3 AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 22 9.6 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 22 9.6 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 22 9.6 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 109 bits (261), Expect = 6e-26 Identities = 52/84 (61%), Positives = 65/84 (77%) Frame = +3 Query: 3 QTEKAFQKQATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTGNVSXR 182 Q +AFQKQ + LNRK ++K +R H ++GLGFKTP+EAI GTYIDKKCPFTG++S R Sbjct: 5 QNIRAFQKQLGINLNRKNVSRKKGLRMHHSIGLGFKTPKEAITGTYIDKKCPFTGHISIR 64 Query: 183 GRILTGVVQKMKMQRTIVIRRDYL 254 GRILTGVV+K + + IRRDYL Sbjct: 65 GRILTGVVRKCIV--LLYIRRDYL 86 Score = 85.0 bits (201), Expect = 1e-18 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +2 Query: 278 FEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNNLKVS 412 FEKR+RNM +HLSPCFRDVE GDIVT+GECRPLSKTVRFN LK S Sbjct: 95 FEKRNRNMRLHLSPCFRDVEAGDIVTLGECRPLSKTVRFNVLKES 139 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 5.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +3 Query: 210 KMKMQRTIVIRRDYLTTYPNTIGSRNGTGICPCI 311 KM + + ++ LT+ ++ G G+CPCI Sbjct: 1065 KMNLANALKFVKNKLTSQIASV-QPTGKGVCPCI 1097 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 22.6 bits (46), Expect = 7.3 Identities = 9/34 (26%), Positives = 13/34 (38%) Frame = -3 Query: 400 IIESNCFGQRSAFADRYNITNLHVPEARRQMHGH 299 I + G+ N N H+P+ R GH Sbjct: 109 IADERAIGESDVIMSFLNKANRHLPKIRHHRGGH 142 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +2 Query: 74 HASP*ECWFRLQNSQRGD*GYLH 142 H P EC + +S GYLH Sbjct: 82 HYEPMECHSAVNSSSNSSTGYLH 104 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 69 SSSCHLSCSGKRWPVS 22 +SSC L +G RW VS Sbjct: 447 ASSCFLPEAGARWDVS 462 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 22.2 bits (45), Expect = 9.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 246 DYLTTYPNTIGSRNGT 293 DY+ P+TIG +GT Sbjct: 733 DYMRRNPSTIGQMSGT 748 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 467,386 Number of Sequences: 2352 Number of extensions: 9365 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -