BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30248 (451 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 1.6 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 23 3.8 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 23 3.8 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 23 3.8 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 23 3.8 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.6 bits (51), Expect = 1.6 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -2 Query: 93 APVLSAQLITAPTGRPRE--IRNFAPAEP 13 APV+ + ++TAP RP + FAP EP Sbjct: 91 APVVPSSVVTAPPARPSQPPTTRFAP-EP 118 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 23.4 bits (48), Expect = 3.8 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 205 TP-EKGNAGSGHQAAETVRRRDGVFIY 282 TP E G G +AAE +DG+ +Y Sbjct: 406 TPLEYGCVGLSEEAAEAAHGKDGIEVY 432 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 23.4 bits (48), Expect = 3.8 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 205 TP-EKGNAGSGHQAAETVRRRDGVFIY 282 TP E G G +AAE +DG+ +Y Sbjct: 382 TPLEYGCVGLSEEAAEAAHGKDGIEVY 408 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 23.4 bits (48), Expect = 3.8 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 205 TP-EKGNAGSGHQAAETVRRRDGVFIY 282 TP E G G +AAE +DG+ +Y Sbjct: 379 TPLEYGCVGLSEEAAEAAHGKDGIEVY 405 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 23.4 bits (48), Expect = 3.8 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +2 Query: 107 VIAVQGI--KGRLNRLPAAGSGDMIVATVKKG 196 ++A QG+ G L P AGSG ++VA K G Sbjct: 208 LMANQGLVESGHLVFDPFAGSGSLLVAAAKFG 239 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 498,917 Number of Sequences: 2352 Number of extensions: 10757 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38268990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -