BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30248 (451 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 27 0.094 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 26 0.17 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 3.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 6.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 8.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.2 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 27.1 bits (57), Expect = 0.094 Identities = 12/55 (21%), Positives = 21/55 (38%) Frame = -1 Query: 235 DHCRHYLFPEFRFTLFDCGHNHVPGTGRRQSVQATFDTLDSDHIQILCPCVVGAV 71 D C Y + +T DCG P +R Q + + + + P V+ + Sbjct: 471 DQCEEYEYVHDEYTCMDCGPGKWPHEDKRGCYQLAINHIRWNSAFAIAPAVISCL 525 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 26.2 bits (55), Expect = 0.17 Identities = 12/55 (21%), Positives = 21/55 (38%) Frame = -1 Query: 235 DHCRHYLFPEFRFTLFDCGHNHVPGTGRRQSVQATFDTLDSDHIQILCPCVVGAV 71 D C Y + +T DCG P +R Q + + + + P V+ + Sbjct: 561 DQCEEYEYVYDEYTCMDCGPGKWPHEDKRGCYQLAINHIRWNSAFAIAPAVISCL 615 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 3.6 Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 159 VPGT*LWPQSKRVNLNSGKR--*CRQWSSGSGN 251 +P T LW ++ R+ +++ K+ + WS S N Sbjct: 439 IPSTTLWQRAHRLGIDTPKKDGPTKSWSDESLN 471 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 213 FRSSGLPFLTVATIMSPEPAAGSLFRRPLIP 121 F S +PF++ I++ P + RP+IP Sbjct: 1034 FHYSVVPFVSNHDILNLRPLSMEKGTRPMIP 1064 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -1 Query: 247 PLPDDHCRHYLFPEFRFTLFD 185 PL +DH HY P FD Sbjct: 199 PLKEDHDDHYGVPTLEELGFD 219 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 8.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 65 VINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSG 166 +IN +++ G K AV+ +N A+GSG Sbjct: 571 IINSSNDEGGKTSPNSAVRKCMSPINGSGASGSG 604 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,854 Number of Sequences: 438 Number of extensions: 2907 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -