BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30246 (726 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1A4J2 Cluster: ALK-EXO; n=4; Granulovirus|Rep: ALK-EXO... 36 0.77 UniRef50_Q8I2K6 Cluster: Putative uncharacterized protein PFI150... 35 2.4 >UniRef50_Q1A4J2 Cluster: ALK-EXO; n=4; Granulovirus|Rep: ALK-EXO - Choristoneura occidentalis granulovirus Length = 403 Score = 36.3 bits (80), Expect = 0.77 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +1 Query: 487 NKT---IKIHRLSTNGKYKIKYYSGLL-RNGPLHCNRTHSTRQLRLLLLTVFVKNAFFVI 654 NKT I+ + +T G Y++++ + L+ RNGPLH T R + ++V NA + Sbjct: 160 NKTLEQIRREKNNTRGAYRVEHTALLVNRNGPLHVTVTERNEHYRQMQSQIYVTNAIMAV 219 Query: 655 NMHK 666 M K Sbjct: 220 YMVK 223 >UniRef50_Q8I2K6 Cluster: Putative uncharacterized protein PFI1500w; n=2; cellular organisms|Rep: Putative uncharacterized protein PFI1500w - Plasmodium falciparum (isolate 3D7) Length = 4530 Score = 34.7 bits (76), Expect = 2.4 Identities = 18/62 (29%), Positives = 32/62 (51%) Frame = +1 Query: 529 YKIKYYSGLLRNGPLHCNRTHSTRQLRLLLLTVFVKNAFFVINMHKEENLEITKLTRETK 708 YK YY + +H N + ++ LT+F KN F +IN +K++N+ + +K Sbjct: 4330 YKYNYYLYYIHKNKVHINHNNDVSYIQNNPLTLF-KNKFNIIN-NKDDNMNLNLNQSNSK 4387 Query: 709 CK 714 C+ Sbjct: 4388 CQ 4389 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,961,287 Number of Sequences: 1657284 Number of extensions: 10565953 Number of successful extensions: 18658 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18655 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 59090914597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -