BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30245 (639 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1259.15c |ubc11|ubcdp, ubcp4|ubiquitin conjugating enzyme E2... 31 0.19 SPAC1F12.09 |gpi17||pig-S|Schizosaccharomyces pombe|chr 1|||Manual 27 1.7 SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|ch... 26 4.0 SPBC17D1.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 9.2 SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 25 9.2 >SPCC1259.15c |ubc11|ubcdp, ubcp4|ubiquitin conjugating enzyme E2-C |Schizosaccharomyces pombe|chr 3|||Manual Length = 176 Score = 30.7 bits (66), Expect = 0.19 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -1 Query: 585 PGISDLPLDTPNVRSWGSTSLGPSALQHELLPFSI 481 PGIS P N+ W T GPS +E L F I Sbjct: 46 PGISAFPDSDSNLLHWAGTITGPSDTYYEGLKFKI 80 >SPAC1F12.09 |gpi17||pig-S|Schizosaccharomyces pombe|chr 1|||Manual Length = 554 Score = 27.5 bits (58), Expect = 1.7 Identities = 23/84 (27%), Positives = 33/84 (39%), Gaps = 1/84 (1%) Frame = -2 Query: 527 PWDLLLFSTNCFRSASDISGQVSFELWTWRVPLRFT-QVKFVQKSEDVHFSPIGFSSPST 351 P +L + NC A S QV E+W+ T + + V FSP S Sbjct: 190 PSELAILIVNCLWEA--FSPQV-MEVWSKFTRFSSTVEPSRAETKRTVQFSPQYRVLLSL 246 Query: 350 TQATGSHLPQHWPLSASAGTYFQP 279 G+H P +W + + YF P Sbjct: 247 LVGEGNHEPINWDIENAIQKYFNP 270 >SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 546 Score = 26.2 bits (55), Expect = 4.0 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -1 Query: 198 SHSYRWGLPLLADLVDIILVSARVLHISG 112 SHSY+W + + ++ I++ A ++ SG Sbjct: 101 SHSYKWWIVIQVSVITIVVTFASSVYSSG 129 >SPBC17D1.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 250 Score = 25.0 bits (52), Expect = 9.2 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 514 RRSQGSAAPRSNVRRVEWEIRY 579 R+ QGS + +S V+ ++W+I Y Sbjct: 170 RQEQGSKSMQSRVKPMDWKILY 191 >SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1096 Score = 25.0 bits (52), Expect = 9.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 529 FPGTFCSSARTASVQHP 479 F GTFC++ R ++ HP Sbjct: 554 FNGTFCATIRASNTPHP 570 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,325,447 Number of Sequences: 5004 Number of extensions: 44384 Number of successful extensions: 160 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -